PRGDB00048195 (P0434B04.37)

From PRG Wiki
Jump to: navigation, search
P0434B04.37
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13872872 (AP002540)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0434B04.

DNA Sequence

ATGGAGGATCCAGGGATAGATTCATGGTGGAAGAACATGAGAAATGTTATGTTTGATGTCGATGACATCGTGGATCTTTTCATGGTTCATTCACAGAAGTTTTTGCTGCCACCAAGGCCGGTATGTTGCAATCAGCCCTTGTTCTCTAGCTTTGCAAAGTTTTCATTTGATCACAGGATTGCCAAAAGAATCGATAATATAAATGAAAAGTTTGAAGAAATTAAAATGAACAAAGAGATGTTTGGCTTCGAGAGAACCAACCGGCAACAAGTCCAGATAACAATTGTTGACAGAAGTCAGACATCTCCTGTAGATGAACTTGAGGTTGTTGGAGAAGATATCAGAAGGGCTGTTGATGACATGGTCAAAATGATTGTTAGTAACTACAATGACAACAGGTCAACTGTTTTTGGGATCCAGGGGATGGGAGGCATCGGTAAGACAACATTAGCTCAAAAGATATACAATGAACAGAGGATAAGGGAGAAATTCCAAGTTCATATATGGTTGTGTATTTCTCAGAATTACACAGAGACCAGTTTGTTAAAACAGGCAATAAGAATGGCTGGAGGAATTTGTGATCAGCTGGAGACTAAGACTGAGCTTCTACCGCTTCTAGTGGACACTATTAGAGGGAAGAGTGTTTTTCTTGTGCTGGATGATGTTTGGAAATCTGATGTATGGATTGATCTTCTTCGATCGCCTTCCGAGAGAGGCTTGAATTCTCGTATCCTTGTGACCTCAAGAAACCTGGATGTTTTGGTCGAAATGCATGCAACTTATACCCACAGGGTAAACAAAATGAATGATTACGATGGCCTAGAACTGCTGATGAAGATGTCATTAGGGCCATACGAGCAAAGAAGAGAATTCAGTGGTGTTGGGTATCAAATTGTCAAAAAGTGTGATGGCCTTCCTCTTGCCATCAAAGTTGTTGCAGGTGTCCTATCTAGTAAGAAAACAAAGGCAGAATGGGAGAGCATCCGAGATAGCAAATGGTCTATTCATGGACTTCCCAAAGAACTAGGAGGTCCTCTGTACTTAAGCTACAGCAACTTACCTCCTGAACTTAAGCAATTCTTTCTCTGGTGTGCTTTGTTACCATCAAATTTTGGGATCCATCGTGATGCTGTCGCTTACTGGTGGGTCGCTGAAGGCTTTGTGACGAAAATGCATGGGTACTCAATACATGAAGCCGCAGAAGAATACTACCATGAGCTAATTAGAATGAATCTTCTGCAGCCAAAACCAGAGTTTGTTGACAAATGGATGTCAACGATGCATGATCTTTTGAGGTCACTTGGACAATTTTTGACAAAGGATCATTCCTTATTCATGAATATGGAAAATAGCAAAACCTTACTGAATCTACGTCACTTAGTAATAAGCAATGATGTAAAAGAAATACCTGCTATAGAAGAGCTGAAGTGCTTGAGGAGCCTCCTAATTTTTAATAACAAGAACTTTAAGACAATTAATAAGGACATTTTCAGAGAGCTCAAGCATATTCGTGTCTTAGTTCTCAGTGGAACAAGCATCCAAGTCATACCAGAGTCGGTGGGAAACTTGTTGCTACTGAGGTTGCTAGATCTAAGCTATACAAAAATCAAAAAACTCCCTGAATCCATAGGAAATCTTACCAGCCTTGAATACCTTTCTTTGCACTGTTGCAGACATTTGGATAGCCTGCCAGCTAGTTTGATGAGACTGTCCAACATAAGTTTCCTTGAGCTAGAACAAACTGGAATCGACCATGTTCCAAAAGGGATCGCGAAGTTTCAGAAACTCTACAACCTTAAAGGAGTTTTCGAGAGTGCATCTGGATTCAGGCTAGATGAACTGCAATGTCTCCCCAACATCCAACGTCTCCGGATTGTAAAGCTAGAAAAAGCAACGCCAGGGGGTGCATTTGTACTCAGGAACAGTCTTCGTCTTCGAGAACTGTGGTTTCGCTGCACAATGGGAGCTAATACTCATGATATTACCCACTACCAGATGAACGAGATTGAGAGAATTCAACAAGTCTATGAGATGCTAAGTCCATCATCAAGCCTAATTTATTTATTTTTTGAGGGGTTTCCTGGTGTAAGGTTCCCAGATTGGTTGTGCTCAGAACCAGAGTATAAGATGCCAAATTTGGGACATATGTACCTCAACGAGTGCATTTCATGCTCTGAGCTTCCACCAGCAGGTCAGATGCCAGAACTACTAATTCTTCAGATCAGATGTGCAGATGCAGTAGTGAATATTGGTTCAGAGCTCCTAGGAAAAGGCGTCAGCAGTGCCACGCATATAACTATTTTCCCAAAGCTCAAATTGCTTCACATCATTGATATGAGCAATTTGGAAAGTTGGTCTCTTAACACAGGGAATTTGCGTGGTAGATCTGAACAGCTCGTTCTGATGCCTTGCCTTAAGCGTCTGTTTCTTAATGGCTGCCCAAAACTAAGGGCTCTCCCTGAAGACTTGCATAGGATTGCTAACTTAAGAAGAATCCACATTGAAGGTGCTCACACGCTGCATGAAATTGACAACCTTCCTTCAGTGTTATGGCTCAAGGTCAAGAATAACAGGTGTTTGAGGAGAATTTCCAATCTCTGTATTCTGCAGGACTTGTTTGCACAGGACTGTCCAGCGCTGGATCAGGCAGAGAATCTAATCTCACTAAAGAGACTCCACATGGTTGATTGCCAGAATGCAAAGCAATTCAGAATGTGCCTCCTAGAAGACCAACAACTTGCAGTCGATGTTGTTACAGTTGGTGCAGATGGCAGGGATATCTTTCCAGATGAAACTCTCTATAATTAG


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Oryza sativa Japonica Group].

MEDPGIDSWWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNYNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRILVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKTLLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRLHMVDCQNAKQFRMCLLEDQQLAVDVVTVGADGRDIFPDETLYN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF173
9-892 PTHR23155:SF173,OS08G0332600 PROTEIN

WWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNYNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRILVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKTLLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRL

HMMPanther: PTHR23155
9-892 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WWKNMRNVMFDVDDIVDLFMVHSQKFLLPPRPVCCNQPLFSSFAKFSFDHRIAKRIDNINEKFEEIKMNKEMFGFERTNRQQVQITIVDRSQTSPVDELEVVGEDIRRAVDDMVKMIVSNYNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRILVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMHGYSIHEAAEEYYHELIRMNLLQPKPEFVDKWMSTMHDLLRSLGQFLTKDHSLFMNMENSKTLLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRL

Gene3D: G3DSA:3.40.50.300
116-252 G3DSA:3.40.50.300

RAVDDMVKMIVSNYNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRILVTSRNLD

superfamily: SSF52540
117-331 SSF52540

AVDDMVKMIVSNYNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRILVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDS

HMMPfam: PF00931
IPR002182
120-392 NB-ARC,NBS
NB-ARC

DMVKMIVSNYNDNRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQAIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRSPSERGLNSRILVTSRNLDVLVEMHATYTHRVNKMNDYDGLELLMKMSLGPYEQRREFSGVGYQIVKKCDGLPLAIKVVAGVLSSKKTKAEWESIRDSKWSIHGLPKELGGPLYLSYSNLPPELKQFFLWCALLPSNFGIHRDAVAYWWVAEGFVTKMH

FPrintScan: PR00364
IPR000767
136-151 DISEASERSIST
Disease resistance protein

VFGIQGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
209-223 DISEASERSIST
Disease resistance protein

TIRGKSVFLVLDDVW

FPrintScan: PR00364
IPR000767
302-316 DISEASERSIST
Disease resistance protein

CDGLPLAIKVVAGVL

Gene3D: G3DSA:3.80.10.10
445-651 G3DSA:3.80.10.10

FMNMENSKTLLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFR

superfamily: SSF52058
450-825 SSF52058,LRR

NSKTLLNLRHLVISNDVKEIPAIEELKCLRSLLIFNNKNFKTINKDIFRELKHIRVLVLSGTSIQVIPESVGNLLLLRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLPASLMRLSNISFLELEQTGIDHVPKGIAKFQKLYNLKGVFESASGFRLDELQCLPNIQRLRIVKLEKATPGGAFVLRNSLRLRELWFRCTMGANTHDITHYQMNEIERIQQVYEMLSPSSSLIYLFFEGFPGVRFPDWLCSEPEYKMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHR

HMMPfam: PF12799
526-564 LRR_4,Leucine Rich repeats (2 copies)

LRLLDLSYTKIKKLPESIGNLTSLEYLSLHCCRHLDSLP

FPrintScan: PR00364
IPR000767
544-560 DISEASERSIST
Disease resistance protein

GNLTSLEYLSLHCCRHL

Gene3D: G3DSA:3.80.10.10
709-904 G3DSA:3.80.10.10

KMPNLGHMYLNECISCSELPPAGQMPELLILQIRCADAVVNIGSELLGKGVSSATHITIFPKLKLLHIIDMSNLESWSLNTGNLRGRSEQLVLMPCLKRLFLNGCPKLRALPEDLHRIANLRRIHIEGAHTLHEIDNLPSVLWLKVKNNRCLRRISNLCILQDLFAQDCPALDQAENLISLKRLHMVDCQNAKQFR


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox