PRGDB00048196 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGTCCTCCATTATTCTTACTCAGACACCATCAGTACCACGACGCCTACTGCTCCTCCTACAGCTCTCGTTTCTGCTCCTCCTCAGCTCCGCCAGCAATGCTGTCACGCCGGCTGGGGTGCCATGCCGGCCAGACCAGGCGGCCGCGTTGCTCCGGCTGAAACGCTCATTCGCCGTCACCAGCAACTCCGTCACCGCCTTCCGGTCATGGCGGGCCGGCACCGACTGCTGCGGCTGGGAGGGCGTTGGCTGCGCCGCCGGCGCCGGCGCCAACAATGGCCGCGCCGTGACATCCCTTCATCTGGGTGACTGGGGCTTGGAGAGTGCAGGCATCGACCCTGCACTCTTCGAGCTAACCTCTCTGGAGTATCTAAACCTCGCCTATAACAACTTCGGTGGGTCAAAGATTCCTTCTGATGGATTTGAGCGTCTCATCAGGCTCACACATCTGAATCTTTCCAGCTCTGGATTCACCGGACAGGTGCCAGCCAGCATCGGCAACCTGACGAGTTTGGTATCACTCGACCTTTCCACTTATTTCATGATCGTGGAGATACCCGATGATGCTTATGAGACGCTTATATCTCAAACTGCTAATTCCATATGGCTCATAGAGCCAAATTTTGAAACCTTTATCTCAAAACTCACAAACTTGAGGGATCTCCACCTCGGCTATGTGGACATGTCCAACAGTGGAGCGCAGTGGTGTGATGCTCTAGCCAATTCCTCTCCTAATCTTCAGGTTATTAGCTTACCATTCTGTTCAATCTCTGGCCCTATCTGCCGCTCACTTTCCCTTTTGCAGTCTCTTGCTGCCCTTAACTTGCAACATAACAATCTGTCTGGTCCAATCCCAGACTTCTTGTCAAACTTATCCAATTTGAGTGTTCTCCGACTTAACCATAATGAGCTTGAAGGATGGGTTTCTCCGGCAATCTTTGGACAAAAGAATCTTGTCACAATTGATCTCCACCATAATCTTGGGATCTCTGGTATTCTCCCAAATTTCTCAGCTGACAGTAGGCTGGAGGAATTGCTCGTTGGCCAGACTAATTGCTCGGGTTTAATACCAAGTTCCATTGGAAATCTCAAATTTTTGAAGCAGCTAGACCTCGGTGCGTCTGGTTTTTTTGGAGAGCTGCCCTCATCAATTGGTAAGCTAGAATCCTTGAATGCATTGGGGATATCCGGAGTGGGACTAGAAGGGCCATTACCATCATGGGTTGCAAACTTAACCTCTTTGACGGCTCTTGTGTTCTCTGATTGTGGGTTATCCGGATCGATACCTTCTTTCATAGGAGATTTGAAGGAATTGAGAACATTAGCGTTGTGTAACTGCAAATTTTCCGCTGTGGTCGATGGAGAATATAACTCATCAGTTTCTCTTCCCCAAATTGTGCTCCTATATTTACCGGGTTGCAGCATGTCTAAGTTCCCTATTTTCTTGAGGCACCAATATGAAATTAATGGCCTCGACCTTTCCGACAACGAAATTAACGGTACTATACCGCATTGGGCATGGGAAACTTGGAATTATATTTCCCTTTTGGGCCTATCCGGCAATAGATTTACGAGTGTGGGATATGACCCTCTTCTTCCCTTACAAGTAGATTTGCTTGATCTTAGCAATAACATGCTTGAAGGGTCCATTCCGATTCCTCGAGGCTCTTCAACATCTCTCAAATATTCAAACAATGGGTTCTCATCCATGCCATCTAATTTTAGTGCTCATCTTAGAGATGTTACCTTTTTCATGGCCGACGGAAATGAAATCTCTGGAAATATTCCTTTGGAGTTTTGCAGTGCTAAGAGTTTACAACTCCTTGATCTGTCTTACAACAACTTCAATGGATCAATCTCTTCTTGTTTAATGGACAGTGTTAGCACGCTGCAAGTATTAAATCTGAAAGGAAATGAACTTCATGGGGTGTTGCCAGACGATATCAAAGAAGGCTGTTCATTTCAGGCATTAGATATTAGCGGAAATTTGATAGAGGGGAAACTACCAAGATCATTAGTTGCTTGCAAAAACTTGGAGGTATTTGATGTTGGGTTCAATCAAATTAGTGACACCTTTCCATGTTGGATGAGTACTCTTCCGAGACTTCAAGTCATTGCCCTCAGATCTAACAAGTTCTTCGGACAGGTCGCACAATCTGCTGTAGAGAAAAATTCTTGTGAATTTCCAGCTGCAAGAATTATTGATCTAGCCTCAAACAACTTCTCGGGTCCATTGCCACAAGATCAATGGTTTAAGAAATTGAAGTCCATGATGATCGGATACTCGAATACGTCATTAGTCATGGATCATGAAGTACCACGAGTAGGAAGGTACAAATTCAGTACTACGATCACATATAAAGGGAGCGCCGTCACATTGACCAAGATTTTGAGGACATTTGTATTCATCGATGTCTCAGAAAACAAATTCCATGGGAGCATTCCAGGGACCATTGGAGAACTTATTCTGTTACACGCACTCAACATGTCACACAACTTCTTGACAGGACCGATTCCATCTCAACTCGGCCATTTGAACCAGTTGGAGGCTTTGGACATGTCCTCAAATGAGCTTTCAGGAGTAATTCCTCAGGAGCTAGCATCCTTGGACTTCCTTGCAATATTGAACCTGTCATACAATAAGCTAGAGGGAAGAATACCACCACAGTCACCTCATTTCTCTACATTCTCCAGCATCTCATTTCTGGGGAACAAGGGTTTGTGCGGCCTTCCTCTGTCGACAGGATGCAGCAACACGACATCTCTGAATGTGATCCCTTCTGAGAAGAATCCTGTAGACATCGTGCTATTCCTTTCTGCTGGACTGGGATTCGGCCTTGGATTTGCCATTGCAATTGTAGTAGCATGGGGAATTCCCATTAGGAAACGGTCCACAGTAAGGCAGAGAGCTCTCTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein -like verticillium wilt disease resistance protein -like [Oryza sativa Japonica Group].

MSSIILTQTPSVPRRLLLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVRQRAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF520
17-971 PTHR26393:SF520

LLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVRQRAL

HMMPanther: PTHR26393
17-971 PTHR26393,FAMILY NOT NAMED

LLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVRQRAL

Gene3D: G3DSA:3.80.10.10
41-232 G3DSA:3.80.10.10

PCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSG

HMMPfam: PF08263
IPR013210
44-84 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGC

superfamily: SSF52047
98-449 SSF52047,LRR

SLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFS

HMMPfam: PF13855
111-155 LRR_8,Leucine rich repeat

IDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSS

Gene3D: G3DSA:3.80.10.10
241-441 G3DSA:3.80.10.10

NSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTL

superfamily: SSF52075
411-551 SSF52075

LTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIP

Gene3D: G3DSA:3.80.10.10
442-550 G3DSA:3.80.10.10

ALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSI

superfamily: SSF52058
554-916 SSF52058,LRR

RGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGC

Gene3D: G3DSA:3.80.10.10
558-728 G3DSA:3.80.10.10

TSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEF

HMMPfam: PF13855
656-711 LRR_8,Leucine rich repeat

ALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNK

Gene3D: G3DSA:3.80.10.10
803-913 G3DSA:3.80.10.10

IDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox