PRGDB00048196 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGTCCTCCATTATTCTTACTCAGACACCATCAGTACCACGACGCCTACTGCTCCTCCTACAGCTCTCGTTTCTGCTCCTCCTCAGCTCCGCCAGCAATGCTGTCACGCCGGCTGGGGTGCCATGCCGGCCAGACCAGGCGGCCGCGTTGCTCCGGCTGAAACGCTCATTCGCCGTCACCAGCAACTCCGTCACCGCCTTCCGGTCATGGCGGGCCGGCACCGACTGCTGCGGCTGGGAGGGCGTTGGCTGCGCCGCCGGCGCCGGCGCCAACAATGGCCGCGCCGTGACATCCCTTCATCTGGGTGACTGGGGCTTGGAGAGTGCAGGCATCGACCCTGCACTCTTCGAGCTAACCTCTCTGGAGTATCTAAACCTCGCCTATAACAACTTCGGTGGGTCAAAGATTCCTTCTGATGGATTTGAGCGTCTCATCAGGCTCACACATCTGAATCTTTCCAGCTCTGGATTCACCGGACAGGTGCCAGCCAGCATCGGCAACCTGACGAGTTTGGTATCACTCGACCTTTCCACTTATTTCATGATCGTGGAGATACCCGATGATGCTTATGAGACGCTTATATCTCAAACTGCTAATTCCATATGGCTCATAGAGCCAAATTTTGAAACCTTTATCTCAAAACTCACAAACTTGAGGGATCTCCACCTCGGCTATGTGGACATGTCCAACAGTGGAGCGCAGTGGTGTGATGCTCTAGCCAATTCCTCTCCTAATCTTCAGGTTATTAGCTTACCATTCTGTTCAATCTCTGGCCCTATCTGCCGCTCACTTTCCCTTTTGCAGTCTCTTGCTGCCCTTAACTTGCAACATAACAATCTGTCTGGTCCAATCCCAGACTTCTTGTCAAACTTATCCAATTTGAGTGTTCTCCGACTTAACCATAATGAGCTTGAAGGATGGGTTTCTCCGGCAATCTTTGGACAAAAGAATCTTGTCACAATTGATCTCCACCATAATCTTGGGATCTCTGGTATTCTCCCAAATTTCTCAGCTGACAGTAGGCTGGAGGAATTGCTCGTTGGCCAGACTAATTGCTCGGGTTTAATACCAAGTTCCATTGGAAATCTCAAATTTTTGAAGCAGCTAGACCTCGGTGCGTCTGGTTTTTTTGGAGAGCTGCCCTCATCAATTGGTAAGCTAGAATCCTTGAATGCATTGGGGATATCCGGAGTGGGACTAGAAGGGCCATTACCATCATGGGTTGCAAACTTAACCTCTTTGACGGCTCTTGTGTTCTCTGATTGTGGGTTATCCGGATCGATACCTTCTTTCATAGGAGATTTGAAGGAATTGAGAACATTAGCGTTGTGTAACTGCAAATTTTCCGCTGTGGTCGATGGAGAATATAACTCATCAGTTTCTCTTCCCCAAATTGTGCTCCTATATTTACCGGGTTGCAGCATGTCTAAGTTCCCTATTTTCTTGAGGCACCAATATGAAATTAATGGCCTCGACCTTTCCGACAACGAAATTAACGGTACTATACCGCATTGGGCATGGGAAACTTGGAATTATATTTCCCTTTTGGGCCTATCCGGCAATAGATTTACGAGTGTGGGATATGACCCTCTTCTTCCCTTACAAGTAGATTTGCTTGATCTTAGCAATAACATGCTTGAAGGGTCCATTCCGATTCCTCGAGGCTCTTCAACATCTCTCAAATATTCAAACAATGGGTTCTCATCCATGCCATCTAATTTTAGTGCTCATCTTAGAGATGTTACCTTTTTCATGGCCGACGGAAATGAAATCTCTGGAAATATTCCTTTGGAGTTTTGCAGTGCTAAGAGTTTACAACTCCTTGATCTGTCTTACAACAACTTCAATGGATCAATCTCTTCTTGTTTAATGGACAGTGTTAGCACGCTGCAAGTATTAAATCTGAAAGGAAATGAACTTCATGGGGTGTTGCCAGACGATATCAAAGAAGGCTGTTCATTTCAGGCATTAGATATTAGCGGAAATTTGATAGAGGGGAAACTACCAAGATCATTAGTTGCTTGCAAAAACTTGGAGGTATTTGATGTTGGGTTCAATCAAATTAGTGACACCTTTCCATGTTGGATGAGTACTCTTCCGAGACTTCAAGTCATTGCCCTCAGATCTAACAAGTTCTTCGGACAGGTCGCACAATCTGCTGTAGAGAAAAATTCTTGTGAATTTCCAGCTGCAAGAATTATTGATCTAGCCTCAAACAACTTCTCGGGTCCATTGCCACAAGATCAATGGTTTAAGAAATTGAAGTCCATGATGATCGGATACTCGAATACGTCATTAGTCATGGATCATGAAGTACCACGAGTAGGAAGGTACAAATTCAGTACTACGATCACATATAAAGGGAGCGCCGTCACATTGACCAAGATTTTGAGGACATTTGTATTCATCGATGTCTCAGAAAACAAATTCCATGGGAGCATTCCAGGGACCATTGGAGAACTTATTCTGTTACACGCACTCAACATGTCACACAACTTCTTGACAGGACCGATTCCATCTCAACTCGGCCATTTGAACCAGTTGGAGGCTTTGGACATGTCCTCAAATGAGCTTTCAGGAGTAATTCCTCAGGAGCTAGCATCCTTGGACTTCCTTGCAATATTGAACCTGTCATACAATAAGCTAGAGGGAAGAATACCACCACAGTCACCTCATTTCTCTACATTCTCCAGCATCTCATTTCTGGGGAACAAGGGTTTGTGCGGCCTTCCTCTGTCGACAGGATGCAGCAACACGACATCTCTGAATGTGATCCCTTCTGAGAAGAATCCTGTAGACATCGTGCTATTCCTTTCTGCTGGACTGGGATTCGGCCTTGGATTTGCCATTGCAATTGTAGTAGCATGGGGAATTCCCATTAGGAAACGGTCCACAGTAAGGCAGAGAGCTCTCTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein -like verticillium wilt disease resistance protein -like [Oryza sativa Japonica Group].

MSSIILTQTPSVPRRLLLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVRQRAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF520
17-971 PTHR26393:SF520

LLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVRQRAL

HMMPanther: PTHR26393
17-971 PTHR26393,FAMILY NOT NAMED

LLLLQLSFLLLLSSASNAVTPAGVPCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIPIPRGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGCSNTTSLNVIPSEKNPVDIVLFLSAGLGFGLGFAIAIVVAWGIPIRKRSTVRQRAL

Gene3D: G3DSA:3.80.10.10
41-232 G3DSA:3.80.10.10

PCRPDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGCAAGAGANNGRAVTSLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSG

HMMPfam: PF08263
IPR013210
44-84 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLRLKRSFAVTSNSVTAFRSWRAGTDCCGWEGVGC

superfamily: SSF52047
98-449 SSF52047,LRR

SLHLGDWGLESAGIDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSSGFTGQVPASIGNLTSLVSLDLSTYFMIVEIPDDAYETLISQTANSIWLIEPNFETFISKLTNLRDLHLGYVDMSNSGAQWCDALANSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFS

HMMPfam: PF13855
111-155 LRR_8,Leucine rich repeat

IDPALFELTSLEYLNLAYNNFGGSKIPSDGFERLIRLTHLNLSSS

Gene3D: G3DSA:3.80.10.10
241-441 G3DSA:3.80.10.10

NSSPNLQVISLPFCSISGPICRSLSLLQSLAALNLQHNNLSGPIPDFLSNLSNLSVLRLNHNELEGWVSPAIFGQKNLVTIDLHHNLGISGILPNFSADSRLEELLVGQTNCSGLIPSSIGNLKFLKQLDLGASGFFGELPSSIGKLESLNALGISGVGLEGPLPSWVANLTSLTALVFSDCGLSGSIPSFIGDLKELRTL

superfamily: SSF52075
411-551 SSF52075

LTSLTALVFSDCGLSGSIPSFIGDLKELRTLALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSIP

Gene3D: G3DSA:3.80.10.10
442-550 G3DSA:3.80.10.10

ALCNCKFSAVVDGEYNSSVSLPQIVLLYLPGCSMSKFPIFLRHQYEINGLDLSDNEINGTIPHWAWETWNYISLLGLSGNRFTSVGYDPLLPLQVDLLDLSNNMLEGSI

superfamily: SSF52058
554-916 SSF52058,LRR

RGSSTSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEFPAARIIDLASNNFSGPLPQDQWFKKLKSMMIGYSNTSLVMDHEVPRVGRYKFSTTITYKGSAVTLTKILRTFVFIDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLSTGC

Gene3D: G3DSA:3.80.10.10
558-728 G3DSA:3.80.10.10

TSLKYSNNGFSSMPSNFSAHLRDVTFFMADGNEISGNIPLEFCSAKSLQLLDLSYNNFNGSISSCLMDSVSTLQVLNLKGNELHGVLPDDIKEGCSFQALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNKFFGQVAQSAVEKNSCEF

HMMPfam: PF13855
656-711 LRR_8,Leucine rich repeat

ALDISGNLIEGKLPRSLVACKNLEVFDVGFNQISDTFPCWMSTLPRLQVIALRSNK

Gene3D: G3DSA:3.80.10.10
803-913 G3DSA:3.80.10.10

IDVSENKFHGSIPGTIGELILLHALNMSHNFLTGPIPSQLGHLNQLEALDMSSNELSGVIPQELASLDFLAILNLSYNKLEGRIPPQSPHFSTFSSISFLGNKGLCGLPLS


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox