PRGDB00048198 (P0550B04.45)

From PRG Wiki
Jump to: navigation, search
P0550B04.45
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 53792823 (AP003770)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0550B04.

DNA Sequence

ATGTCATGGGTGAAGAGGACAGACTGCTGTAAATGGGAAGGCATCACCTGCAGCAGTGATGGCACAGTCACAGATGTCTTGCTGGCTGCTAAGGGCCTCCAAGGGCACATCTCGCCATTGCTCGGCAATCTTACTGGGCTGTTGCACCTCAACCTGTCTCACAACTTACTCAATGGCAACCTACCGATGGAATTGTTGTTCTCCAGAAGCATCATCGTCCTTGACGTTAGCTTCAACCGCCTAGATGGTTCTCTGCCAGAGTTGCAGTCCTCTAGTGGTGGTTTTCCTCTCCAGGTACTGAATATCTCAAGCAATTTATTTACAGGGCAGTTCTCATCCAAACTGTGGGAGGCGATGAAGAATATTGTTGCTCTTAATGCAAGCAACAACAGCTTTACAGGACAGATACCATCTTCTATCTGCATCAACTCCCCATCACTTGCTATCCTTGACCTTTCTTACAACCAATTCAGTGGCAGTATTCCTCCGGAGCTTGGAAATTGCTCCAAGCTGAGAGAGTTCAAGGCTGGCTACAACAATTTTAATGGAGCTCTCCCTGAAGAACTCTTCAGTGCTACCTCGTTGGAGCACTTGTCTCTTCCTAGCAATGATTTACAGGGAGTTCTTGATGGTTCTGACATATTAAAACTCGTCAAGCTGACTGTCCTTGATCTCGGATCGACTGGGCTCAGTGGGAACATCCCGGATTCTATTGGCCAACTAAGCACATTGGAGGAGCTCCGGCTGGACAACAACAACATGTCTGGTGAGCTGCCATCGGCCGTAGGTAACTGCACAAATCTGAGGTACCTCAGCCTCAGAAACAACAAATTTGTGGGAGATCTTAGCAAAGTCAATTTTACCCGGTTGAATTTGAGAATCGCAGATTTCTCAATTAATAACTTCACTGGTACAGTTCCAGAAAGCATATACTCATGCAGCAATCTAATTGCGTTGCGGCTGGCTTTCAACAAGTTTCATGGCCAGCTCTCACCAAGAATGGGCAATCTGAAGTCCATGTCCTTCTTTTCAATAGCCGATAACCATCTCACAAATATCACAAATGCACTTCAGATACTCAAGAGCTGCAAAAACCTTACCGCCGTTCTTATTGGAACCAACTTCAAGGGTGAAACCATATCAAAAAGTGAAACAATTGATGGTTTTGAGAATCTTCGGGTACTGACTATAGATTCCTGTGGATTGGTTGGACAAATTCCCACTTGGATATCAAAGCTCAAAAAACTGGAGGTGTTGGATTTATCAAACAATATGCTCTCTGGAAAAATACCATTTTGGATTAGTGATCTGCCTGTTCTTTTCTATTTAGATATAACAAACAACAGTCTTACAGGGGATATCCCAACTGCGTTGATGAACACGCCGATGCTACAATTAGGAAAGAATGCTGCCCAGTTGGACCCAAATTTCCTTGAATTGCCTGTTTATTGGACACGATCACGTCAATACCGCTTGCTCAACGCTTTTCCTAATGCGTTGAATCTAGGTAACAATGGTTTCACAGGAGTGATTCCCCCAGAGATTGGTCGGTTGAAAATGCTCGACGGCTTCAATATCAGCTTTAACAGGTTATCTGGAGAAATACCACAGCAGATATGCAATCTCACAAACCTGCAATTGCTAGATTTATCAAGCAATCAGCTCACAGGTGAACTACCGTCTGCACTGACTGATATGCACTTCCTTTCTAAATTCAATGTTTCTAACAATGAACTAGAAGGGCCAGTTCCAACTGGAGGACAGTTTGATACATTTCTTAATTCTAGCTATAGTGGGAATTCGAAGCTATGTGGTGCTGTACTCAGTAACCTTTGCAGTCCCACTACAAGAAAAGAAAACTTCACCTCACAGCGGCGCAACTTACGGTGTGCATTAGTCACTGGAATCACCTTGGGAGCACTCGTCGCTCTTGCTTTGCTTGCATGCTTCTTGATTGGGCGGTTGGTATATGATGATCACACCGAAAGCCTAACTCACCTTCAAATGCGGTACCGAAGATAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MSWVKRTDCCKWEGITCSSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPMELLFSRSIIVLDVSFNRLDGSLPELQSSSGGFPLQVLNISSNLFTGQFSSKLWEAMKNIVALNASNNSFTGQIPSSICINSPSLAILDLSYNQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDLQGVLDGSDILKLVKLTVLDLGSTGLSGNIPDSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNFKGETISKSETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSLTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFLSKFNVSNNELEGPVPTGGQFDTFLNSSYSGNSKLCGAVLSNLCSPTTRKENFTSQRRNLRCALVTGITLGALVALALLACFLIGRLVYDDHTESLTHLQMRYRR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF504
1-673 PTHR26393:SF504

MSWVKRTDCCKWEGITCSSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPMELLFSRSIIVLDVSFNRLDGSLPELQSSSGGFPLQVLNISSNLFTGQFSSKLWEAMKNIVALNASNNSFTGQIPSSICINSPSLAILDLSYNQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDLQGVLDGSDILKLVKLTVLDLGSTGLSGNIPDSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNFKGETISKSETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSLTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFLSKFNVSNNELEGPVPTGGQFDTFLNSSYSGNSKLCGAVLSNLCSPTTRKENFTSQRRNLRCALVTGITLGALVALALLACFLIGRLVYDDHTESLTHLQMRYRR

HMMPanther: PTHR26393
1-673 PTHR26393,FAMILY NOT NAMED

MSWVKRTDCCKWEGITCSSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPMELLFSRSIIVLDVSFNRLDGSLPELQSSSGGFPLQVLNISSNLFTGQFSSKLWEAMKNIVALNASNNSFTGQIPSSICINSPSLAILDLSYNQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDLQGVLDGSDILKLVKLTVLDLGSTGLSGNIPDSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNFKGETISKSETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSLTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFLSKFNVSNNELEGPVPTGGQFDTFLNSSYSGNSKLCGAVLSNLCSPTTRKENFTSQRRNLRCALVTGITLGALVALALLACFLIGRLVYDDHTESLTHLQMRYRR

HMMPfam: PF08263
IPR013210
2-18 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SWVKRTDCCKWEGITCS

superfamily: SSF52047
3-278 SSF52047,LRR

WVKRTDCCKWEGITCSSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPMELLFSRSIIVLDVSFNRLDGSLPELQSSSGGFPLQVLNISSNLFTGQFSSKLWEAMKNIVALNASNNSFTGQIPSSICINSPSLAILDLSYNQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLPSNDLQGVLDGSDILKLVKLTVLDLGSTGLSGNIPDSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKF

Gene3D: G3DSA:3.80.10.10
6-201 G3DSA:3.80.10.10

RTDCCKWEGITCSSDGTVTDVLLAAKGLQGHISPLLGNLTGLLHLNLSHNLLNGNLPMELLFSRSIIVLDVSFNRLDGSLPELQSSSGGFPLQVLNISSNLFTGQFSSKLWEAMKNIVALNASNNSFTGQIPSSICINSPSLAILDLSYNQFSGSIPPELGNCSKLREFKAGYNNFNGALPEELFSATSLEHLSLP

HMMPfam: PF00560
IPR001611
146-168 LRR_1
Leucine-rich repeat

SLAILDLSYNQFSGSIPPELGNC

Gene3D: G3DSA:3.80.10.10
202-375 G3DSA:3.80.10.10

SNDLQGVLDGSDILKLVKLTVLDLGSTGLSGNIPDSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNF

superfamily: SSF52058
214-601 SSF52058,LRR

ILKLVKLTVLDLGSTGLSGNIPDSIGQLSTLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLSKVNFTRLNLRIADFSINNFTGTVPESIYSCSNLIALRLAFNKFHGQLSPRMGNLKSMSFFSIADNHLTNITNALQILKSCKNLTAVLIGTNFKGETISKSETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSLTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFLSKFNVSNNELEGPVPTGGQFDTFLNSSYSGNS

HMMPfam: PF12799
243-283 LRR_4,Leucine Rich repeats (2 copies)

TLEELRLDNNNMSGELPSAVGNCTNLRYLSLRNNKFVGDLS

Gene3D: G3DSA:3.80.10.10
383-606 G3DSA:3.80.10.10

SETIDGFENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSLTGDIPTALMNTPMLQLGKNAAQLDPNFLELPVYWTRSRQYRLLNAFPNALNLGNNGFTGVIPPEIGRLKMLDGFNISFNRLSGEIPQQICNLTNLQLLDLSSNQLTGELPSALTDMHFLSKFNVSNNELEGPVPTGGQFDTFLNSSYSGNSKLCGA

HMMPfam: PF13855
390-450 LRR_8,Leucine rich repeat

ENLRVLTIDSCGLVGQIPTWISKLKKLEVLDLSNNMLSGKIPFWISDLPVLFYLDITNNSL

FPrintScan: PR00019
416-429 LEURICHRPT,Leucine-rich repeat signature

LEVLDLSNNMLSGK

HMMPfam: PF13516
542-563 LRR_6,Leucine Rich repeat

LTNLQLLDLSSNQLTGELPSAL

FPrintScan: PR00019
542-555 LEURICHRPT,Leucine-rich repeat signature

LTNLQLLDLSSNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox