PRGDB00048202 (P0415A04.49)

From PRG Wiki
Jump to: navigation, search
P0415A04.49
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20161165 (AP003345)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0415A04.

DNA Sequence

ATGGAGTTCGTGGCGTCCATCGTGGACGCGGTGTTCCGGCCGCTCAAGGACTACTTCGCCCGGACGTTCGGGTATGTCATGTCCTGCGGCGACTACATCGACCTGCTGGGCCACGAGATGGACGAGCTCAAGAGCAAGCGCGACGACGTGAAGCGCCTGGTCGACGTCGCCGAGCGCCGGGGCATGGAGGCCACCAGCCAGGTCAAGTGGTGGCTCGAGTGTGTCTCCAGGCTCGAGGACGCCGCCGCCCGGATCGAGGAGGAGTACCAGGCGCGCCTCCGCCTTCCCCCCGAGCAGGCGCCCGGCCTCAGGGCCACCTACCACCTCAGCCAGAGGGCCGACGAGATGTTCGCCGAGGCCGCCAACCTCAAGGAGAAGGGCGCGTTCCACAAGGTCGCCGACGAGCTTGTGCAGGTCCGCTTCGAGGAGATGCCCAGCGCGGCCGTCGTCGGCATGGACGCTGTGCTTCAGAGGCTCCACGCGTGCGTCCGGCACGGCGACGTGGGCATCGTCGGCATCTACGGCATGGCCGGGGTCGGCAAGACCGCGCTGCTGAACAAGTACAACAACGATTTCCTCATCAACTCGCCGGACATCAATGTCGCCATCAACATCGAAGTCGGCAAGGAGTTCAGTCTGGATGATATCCAGAAAATCATCGGCGACCGCCTCGGCGTGTCGTGGGAGAACAGAACGCCCAGGGAGCGTGCCGGAATGCTCTACAGAGTGCTCACCAAGATGAACTTCGTGCTGCTGCTGGACGACCTCTGGGAGCCACTCAACTTCCAGATGATCGGAATTCCCGTACCTAAGCACAACTCCAAGAGCAAGATCGTGTTGACGACGAGGATTGAGGACGTGTGTGACCGCATGGATGTCCGCCGCAAGCTCAAGATGGAGTGCCTGCCATGGGAGCCCGCTTGGGAGCTCTTCCGCGAGAAGGTCGGGGAGCATCTCATGTTTTCCAGCATTGAGATTCAGGAACAGGCGAAGGCGCTGGCGATGAAGTGTGGCGGCCTGCCGCTCGCGCTCATCACCGTCGGCCGGGCGATGGCCAGCAAGCGCACAGAAAAAGAGTGGAAGCATGCCATCACCGTGCTAAAGGTTGCCCCATGGCAGCTTCTTGGCATGGAGATGGATGTTCTAATGCCTCTCAAGAACAGCTACGATAGTTTGCCCAGTGACAAGCTAAGGCTTTGTCTACTGTATTGCTCACTGTTCCCAGAGGAATTCTCCATTTCTAAGGAATGGATAATAGGGTACTGCATCGGTGAAGGTTTCATTGATGACCTGTACACTGACATGGATGAGATTTATAACAAAGGGCATGACCTTCTTGGTGTTCTCAAGATTGCCTGTTTGCTGGAGAAAGGGGATGACGAGGATCATATCAGTATGCATCCCATGGTCCGTGCCATGGCTCTGTGGATAGCATCAGATTTTGGCACAAAAGAAACAAAATGGCTTGTCCGTGCCGGAGTTGGGCTCAAGGAGGCACCAGGTGCAGAGAAATGGAGCGACGCTGAGCGGATTTCTTTCATGCGAAACAACATTCTTGAGCTGTATGAGAGACCTAATTGCCCTCTGCTGAAAACTTTGATGCTACAGGTCAACCCTGCATTGGATAAGATATGTGACGGCTTCTTCCAATTCATGCCATCTCTCAGGGTTTTAGATTTATCACATACTTCTATCCATGAATTACCTTCCGGGATCAGTTCATTAGTTGAGTTGCAGTACCTTGATTTGTATAACACAAACATCAAATCACTTCCAAGGGAGCTTGGAGCACTGGTAACCCTGCGGTTCCTGCTGCTTTCGCATATGCCACTGGATTTGATACCAGGTGGTGTAATAAGCAGCCTGACAATGCTGCAAGTATTGTACATGGATCTCAGTTATGGAGACTGGAAGGTTGATGCAACCGGAAATGGAGTTGAATTTCTGGAGCTTGAAAGCCTACGCAGGCTCAAGATACTCGATATCACAATACAGTCTCTCGAGGCTCTGGAGAGACTGTCCTTGTCGAATCGCCTCGCTAGCTCGACAAGAAATCTACTCATAAAGACATGTGCTAGCCTTACAAAGGTAGAGCTTCCTTCAAGCAGACTTTGGAAGAACATGACCGGACTCAAGAGAGTGTGGATCGCGAGCTGCAACAACTTAGCGGAGGTAATCATCGATGGCAACACAGAAACTGACCACATGTATAGACAACCTGATGTTATCTCGCAAAGCCGGGGAGATCATTATTCCAATGACGAGCAGCCCATCCTTCCAAACCTGCAAAATATCATCCTTCAGGCACTTCATAAGGTAAAGATCATCTACAAATCCGGATGTGTCCAGAACATAACATCGTTGTACATCTGGTATTGCCATGGGCTGGAGGAGCTGATTACTCTCAGCGATGATGAACAAGGAACAGCGGCAAACAGCAGTGAACAAGCTGCAAGAATTTGCAGAGACATCACACCCTTCCCTAACCTCAAAGAACTGTATCTCCATGGCTTGGCAAACTGCAGGGCATTGTGCAGCACTACGTGCTTCCTGCGGTTCCCCTTGCTGGGGAACCTGAAGATTGTCGACTGCCCGAAGCTGAAGAAGCTCGAGCTCCCTGTCGGTAATCTGAATGCGGTACAATGCACAAGGGAGTGGTGGGATGCGTTGGAGTGGGATGATGCCGAAGTCAAAGCATCTTACGATCCACTGTTCCGTCCACTGCACTGA


Protein sequences

Name Description Sequence
putative disease resistance protein RPS2 putative disease resistance protein RPS2 [Oryza sativa Japonica Group].

MEFVASIVDAVFRPLKDYFARTFGYVMSCGDYIDLLGHEMDELKSKRDDVKRLVDVAERRGMEATSQVKWWLECVSRLEDAAARIEEEYQARLRLPPEQAPGLRATYHLSQRADEMFAEAANLKEKGAFHKVADELVQVRFEEMPSAAVVGMDAVLQRLHACVRHGDVGIVGIYGMAGVGKTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENRTPRERAGMLYRVLTKMNFVLLLDDLWEPLNFQMIGIPVPKHNSKSKIVLTTRIEDVCDRMDVRRKLKMECLPWEPAWELFREKVGEHLMFSSIEIQEQAKALAMKCGGLPLALITVGRAMASKRTEKEWKHAITVLKVAPWQLLGMEMDVLMPLKNSYDSLPSDKLRLCLLYCSLFPEEFSISKEWIIGYCIGEGFIDDLYTDMDEIYNKGHDLLGVLKIACLLEKGDDEDHISMHPMVRAMALWIASDFGTKETKWLVRAGVGLKEAPGAEKWSDAERISFMRNNILELYERPNCPLLKTLMLQVNPALDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNIKSLPRELGALVTLRFLLLSHMPLDLIPGGVISSLTMLQVLYMDLSYGDWKVDATGNGVEFLELESLRRLKILDITIQSLEALERLSLSNRLASSTRNLLIKTCASLTKVELPSSRLWKNMTGLKRVWIASCNNLAEVIIDGNTETDHMYRQPDVISQSRGDHYSNDEQPILPNLQNIILQALHKVKIIYKSGCVQNITSLYIWYCHGLEELITLSDDEQGTAANSSEQAARICRDITPFPNLKELYLHGLANCRALCSTTCFLRFPLLGNLKIVDCPKLKKLELPVGNLNAVQCTREWWDALEWDDAEVKASYDPLFRPLH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-897 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VASIVDAVFRPLKDYFARTFGYVMSCGDYIDLLGHEMDELKSKRDDVKRLVDVAERRGMEATSQVKWWLECVSRLEDAAARIEEEYQARLRLPPEQAPGLRATYHLSQRADEMFAEAANLKEKGAFHKVADELVQVRFEEMPSAAVVGMDAVLQRLHACVRHGDVGIVGIYGMAGVGKTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENRTPRERAGMLYRVLTKMNFVLLLDDLWEPLNFQMIGIPVPKHNSKSKIVLTTRIEDVCDRMDVRRKLKMECLPWEPAWELFREKVGEHLMFSSIEIQEQAKALAMKCGGLPLALITVGRAMASKRTEKEWKHAITVLKVAPWQLLGMEMDVLMPLKNSYDSLPSDKLRLCLLYCSLFPEEFSISKEWIIGYCIGEGFIDDLYTDMDEIYNKGHDLLGVLKIACLLEKGDDEDHISMHPMVRAMALWIASDFGTKETKWLVRAGVGLKEAPGAEKWSDAERISFMRNNILELYERPNCPLLKTLMLQVNPALDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNIKSLPRELGALVTLRFLLLSHMPLDLIPGGVISSLTMLQVLYMDLSYGDWKVDATGNGVEFLELESLRRLKILDITIQSLEALERLSLSNRLASSTRNLLIKTCASLTKVELPSSRLWKNMTGLKRVWIASCNNLAEVIIDGNTETDHMYRQPDVISQSRGDHYSNDEQPILPNLQNIILQALHKVKIIYKSGCVQNITSLYIWYCHGLEELITLSDDEQGTAANSSEQAARICRDITPFPNLKELYLHGLANCRALCSTTCFLRFPLLGNLKIVDCPKLKKLELPVGNLNAVQCTREWWDALEWDDAEV

HMMPanther: PTHR23155:SF107
4-897 PTHR23155:SF107,PUTATIVE DISEASE RESISTANCE PROTEIN RPS2 (PUTATIVE UNCHARACTERIZED PROTEIN) (OS0

VASIVDAVFRPLKDYFARTFGYVMSCGDYIDLLGHEMDELKSKRDDVKRLVDVAERRGMEATSQVKWWLECVSRLEDAAARIEEEYQARLRLPPEQAPGLRATYHLSQRADEMFAEAANLKEKGAFHKVADELVQVRFEEMPSAAVVGMDAVLQRLHACVRHGDVGIVGIYGMAGVGKTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENRTPRERAGMLYRVLTKMNFVLLLDDLWEPLNFQMIGIPVPKHNSKSKIVLTTRIEDVCDRMDVRRKLKMECLPWEPAWELFREKVGEHLMFSSIEIQEQAKALAMKCGGLPLALITVGRAMASKRTEKEWKHAITVLKVAPWQLLGMEMDVLMPLKNSYDSLPSDKLRLCLLYCSLFPEEFSISKEWIIGYCIGEGFIDDLYTDMDEIYNKGHDLLGVLKIACLLEKGDDEDHISMHPMVRAMALWIASDFGTKETKWLVRAGVGLKEAPGAEKWSDAERISFMRNNILELYERPNCPLLKTLMLQVNPALDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNIKSLPRELGALVTLRFLLLSHMPLDLIPGGVISSLTMLQVLYMDLSYGDWKVDATGNGVEFLELESLRRLKILDITIQSLEALERLSLSNRLASSTRNLLIKTCASLTKVELPSSRLWKNMTGLKRVWIASCNNLAEVIIDGNTETDHMYRQPDVISQSRGDHYSNDEQPILPNLQNIILQALHKVKIIYKSGCVQNITSLYIWYCHGLEELITLSDDEQGTAANSSEQAARICRDITPFPNLKELYLHGLANCRALCSTTCFLRFPLLGNLKIVDCPKLKKLELPVGNLNAVQCTREWWDALEWDDAEV

superfamily: SSF52540
130-374 SSF52540

HKVADELVQVRFEEMPSAAVVGMDAVLQRLHACVRHGDVGIVGIYGMAGVGKTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENRTPRERAGMLYRVLTKMNFVLLLDDLWEPLNFQMIGIPVPKHNSKSKIVLTTRIEDVCDRMDVRRKLKMECLPWEPAWELFREKVGEHLMFSSIEIQEQAKALAMKCGGLPLALITVGRAMASKRTEKEWKHAITVLKVAPWQL

Gene3D: G3DSA:3.40.50.300
145-231 G3DSA:3.40.50.300

PSAAVVGMDAVLQRLHACVRHGDVGIVGIYGMAGVGKTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENR

HMMPfam: PF00931
IPR002182
152-428 NB-ARC,NBS
NB-ARC

MDAVLQRLHACVRHGDVGIVGIYGMAGVGKTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENRTPRERAGMLYRVLTKMNFVLLLDDLWEPLNFQMIGIPVPKHNSKSKIVLTTRIEDVCDRMDVRRKLKMECLPWEPAWELFREKVGEHLMFSSIEIQEQAKALAMKCGGLPLALITVGRAMASKRTEKEWKHAITVLKVAPWQLLGMEMDVLMPLKNSYDSLPSDKLRLCLLYCSLFPEEFSISKEWIIGYCIGEGFI

FPrintScan: PR00364
IPR000767
170-185 DISEASERSIST
Disease resistance protein

IVGIYGMAGVGKTALL

FPrintScan: PR00364
IPR000767
243-257 DISEASERSIST
Disease resistance protein

VLTKMNFVLLLDDLW

FPrintScan: PR00364
IPR000767
337-351 DISEASERSIST
Disease resistance protein

CGGLPLALITVGRAM

superfamily: SSF52058
465-865 SSF52058,LRR

SMHPMVRAMALWIASDFGTKETKWLVRAGVGLKEAPGAEKWSDAERISFMRNNILELYERPNCPLLKTLMLQVNPALDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNIKSLPRELGALVTLRFLLLSHMPLDLIPGGVISSLTMLQVLYMDLSYGDWKVDATGNGVEFLELESLRRLKILDITIQSLEALERLSLSNRLASSTRNLLIKTCASLTKVELPSSRLWKNMTGLKRVWIASCNNLAEVIIDGNTETDHMYRQPDVISQSRGDHYSNDEQPILPNLQNIILQALHKVKIIYKSGCVQNITSLYIWYCHGLEELITLSDDEQGTAANSSEQAARICRDITPFPNLKELYLHGLANCRALCSTTCFLRFPLLGNLKIVDCP

Gene3D: G3DSA:3.80.10.10
495-631 G3DSA:3.80.10.10

GLKEAPGAEKWSDAERISFMRNNILELYERPNCPLLKTLMLQVNPALDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNIKSLPRELGALVTLRFLLLSHMPLDLIPGGVISSLTMLQVLYMD

HMMPfam: PF13855
528-588 LRR_8,Leucine rich repeat

PLLKTLMLQVNPALDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNI

FPrintScan: PR00364
IPR000767
550-566 DISEASERSIST
Disease resistance protein

QFMPSLRVLDLSHTSIH

Gene3D: G3DSA:3.80.10.10
648-730 G3DSA:3.80.10.10

FLELESLRRLKILDITIQSLEALERLSLSNRLASSTRNLLIKTCASLTKVELPSSRLWKNMTGLKRVWIASCNNLAEVIIDGN

Gene3D: G3DSA:3.80.10.10
816-872 G3DSA:3.80.10.10

QAARICRDITPFPNLKELYLHGLANCRALCSTTCFLRFPLLGNLKIVDCPKLKKLEL


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox