PRGDB00048203 (OSJNBa0083M16.49)

From PRG Wiki
Jump to: navigation, search
OSJNBa0083M16.49
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15528580 (AP003214)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0083M16.

DNA Sequence

ATGGGCATCAACAAACTCATTAACCTTGTGTCCTTGGACCTTTCCAAGCGCTATGTTAACGATAACAGTGATATCTCTTTTAATGAGAGTGATGATGAGATTATCTTTACAGGTGACAGTTATAATCATCTGCAGGAATCCAGGTTAATGTCCCTAGTAGAAAACCTAAGCAATTTGAAAGAGCTCTACCTCGACCATGTGGATATGTCTACAAATGTAGATGACTGGTGCAAAACCCTTGCTCAATCAGTTCCTCGTCTTCAGGTACTTAGTTTAGATGGTTGCTCTCTCAACACTCCTATTCATCACTCCCTTTTGAGGCTCCATTCTCTCACAGTGATAAATCTTCAGTCCAACCCTGGTATAGCTGTCAATCTATTTCCAGATTTCTTCATGGGTTTCGCCAATTTAACTGTGCTCCGACTTTCTCATAATAATCTCGAAGGGTGGTTTCCTGACAAATTCTTCCAACTGAAAAATCTAAGAATCCTCGATTTGTCCTTTAATATGAATCTGTTAGGGCATTTGCCAAAAGTTCCAACCTCTTTGGAGACATTGAGACTAGAGGGGACCAACTTTTCCTATGCTAAACGAATTTCTTCTAGCAATTTCAATATGCTGAAGGAGTTGGGTCTTGAAGGGAAATTAATTTCTAAGGATTTTCTCACGTCGTTTGGTTTGATCTGGTCTTTATGCCATCTAGAACTCCTTAATTCGGAATTGTTAGGAGATTCAGGATCCAATTTGTTGTCATGGATAGGGGCCCACAAGAACTTGACATGCTTGATACTATCTGAGTTTGACTTCTCTAGCACAAAGCCTTCATCCATTAGTAACTTCAAGAATTTGAGAAGCTTGTGGTTGTTTGGCTGTAACCTCACTAGGCCAATAATGTCTGCAATTGGTGATCTCGTGGACTTGCAAAGCTTGGATATGTCAAACTGCAATACATACAGTTCAATGCCATCTTCAATAGGCAATCTCACAAATTTAAAAAGCTTGTATATCAACAGCCCTGGGTTTTTAGGGCCAATGCCGGCTGCAATTGGCAACCTCAAAAGCTTGAAGAGCATGGTATTCTCAAATTGTGAATTTACTGGGCCAATGCCATCCACAATTGGCAATCTCACTAAGTTGCAGACCTTGGAAATTGCAGCTTGTCGGTTTTCTGGACCAATACCTTATTCAATTGGACAACTTAAGGAATTGAGGGCGTTATTTATTGAAGGGTGCAATATGTCTGGTAGAATACCAAATTCAATTGTCAACATGAGCAAACTGATATATTTGGGGCTTCCAGCAAATTATCTGAGCGGCAAAATTCCAGCACGGCTTTTCACTCTTCCAGCACTACTCTTCTTGGATCTTTTTGGTAATCATTTTTCTGGTCCTATACAAGAGTTTGATGCTGTGCCTTCATATCTGATGAGTTTGCAGTTGACCAGCAACGAATTGACAGGAGAGTTTCCCAAGTCATTCTTTGAACTCACTAGTTTAATTGCTCTAGAAATCGACTTGAACAACTTGGCAGGCTCTGTGGATCTTTCATCTTTTAAAAGGTTAAAAAAGCTCCGTGATTTGAATCTTTCACACAATAACTTGTCTGTCATTATGGATGACGAAGGCGATAACTCTTCATCTACGTATCTCTCTGAACTTAAAGAGCTAGGACTTGCATGTTGCAATATAACTAAATTTCCAAGTATTTTGACTCGTCTGAGTGACATGTCTTATTTGGACCTTTCTTGCAATAAAATCAGTGGGAACATACCAAAGTGGATATGGGAGAAATGGAGCAGTAGCGTCGTGCATTTAAATCTCTCCCACAACATGCTCACCAGTATGGAAGTTGCTTCATATCTTCTCCCTTTTAATAGGCACTTTGAAACTTTGGATCTTAGTTCCAATATGCTTCAAGGACAGATTCCTATACCAAACTTATCAGCTGAATTCTTGGATTATTCACATAATGCATTCTCTTCTATTCTGCCAAACTTCACTTTATATCTTAGTAAAACCTGGTATCTCAGCATGTCCAAGAATAATATAAGTGGAAATATACCACATTCTATTTGCAATTCAAGCCTGCTGGTACTTAACCTGGCGCATAACAACTTTAGTGGGCCATTTCCGTCCTGCCTAATGGAACAAACGTACTTCAGAAACATATTAAATTTGAGGGGAAATCACTTTGAAGGGATGTTACCTACCAATGTTACAAGATGTGCTTTCCAGACAATAGATTTAAATGGGAATAAGATTGAAGGTCGGCTTCCAAGGGCACTAGGTAACTGCACATATTTGGAAGTCCTTGACTTGGGAAATAATAAAATTGCCGACACTTTTCCATCTTGGCTAGGAAGTCTTTCCAATCTTCGTGTCCTTGTCTTGAGATCAAACCGGTTGTACGGTTCTATAGGTTATACGTTTGAGGACAAATCTGGAGATCACTTCCCAAACTTGCAAATCATTGATTTGGCCTCAAACAACTTCACTGGCAGTTTGCATCCGCAATGGTTTGAAAAGTTTATATCTATGAAGAAGTACAATAATACAGGAGAAACTATCAGCCATCGTCATAGCATATCAGATGGATTTTACCAAGATACTGTCACAATCTCATGCAAAGGGTTCTCTATGACTTTTGAAAGGATCTTAACTACCTTGACAGCAATCGACTTATCTGATAATGCATTGGAAGGAAGCATTCCTGAGTCGGTCGGAAAACTTGTTTCACTACATGTGCTAAACCTGTCACATAATGCCTTCAGTGGAAGAATTCCACCCCAGATTGGCGGCATAACTGCTCTGGAGTCACTGGACCTGTCTTCGAATTGGATTTCAGGGGAGATTCCTCAAGAGCTTACTAACCTGACATTTCTAACCGTCTTGAACCTGAGCAATAACCAATTGGAGGGAAAGATACCAGAGTCACGTCAATTTGCAACATTTGAAAACAGTTCATATGAAGGCAACGCAGGACTTTGTGGAGACCCATTGCCTAAATGTGCCAGTTGGAGTCCTCCAAGTGCTGAACCACATGTAGAGAGCTCCTCTGAGCATGTCGATATTGTGATGTTTCTCTTTGTTGGCGTGGGCTTTGGAGTTGGATTTGCAGTAGGTATTCTGATGAAAACGAGTTGGATTAACAGGTGGTTTCACTCGGCGGTCAGCCGCCAACGAACTTGA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein Ve2 putative verticillium wilt disease resistance protein Ve2 [Oryza sativa Japonica Group].

MGINKLINLVSLDLSKRYVNDNSDISFNESDDEIIFTGDSYNHLQESRLMSLVENLSNLKELYLDHVDMSTNVDDWCKTLAQSVPRLQVLSLDGCSLNTPIHHSLLRLHSLTVINLQSNPGIAVNLFPDFFMGFANLTVLRLSHNNLEGWFPDKFFQLKNLRILDLSFNMNLLGHLPKVPTSLETLRLEGTNFSYAKRISSSNFNMLKELGLEGKLISKDFLTSFGLIWSLCHLELLNSELLGDSGSNLLSWIGAHKNLTCLILSEFDFSSTKPSSISNFKNLRSLWLFGCNLTRPIMSAIGDLVDLQSLDMSNCNTYSSMPSSIGNLTNLKSLYINSPGFLGPMPAAIGNLKSLKSMVFSNCEFTGPMPSTIGNLTKLQTLEIAACRFSGPIPYSIGQLKELRALFIEGCNMSGRIPNSIVNMSKLIYLGLPANYLSGKIPARLFTLPALLFLDLFGNHFSGPIQEFDAVPSYLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLRDLNLSHNNLSVIMDDEGDNSSSTYLSELKELGLACCNITKFPSILTRLSDMSYLDLSCNKISGNIPKWIWEKWSSSVVHLNLSHNMLTSMEVASYLLPFNRHFETLDLSSNMLQGQIPIPNLSAEFLDYSHNAFSSILPNFTLYLSKTWYLSMSKNNISGNIPHSICNSSLLVLNLAHNNFSGPFPSCLMEQTYFRNILNLRGNHFEGMLPTNVTRCAFQTIDLNGNKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRLYGSIGYTFEDKSGDHFPNLQIIDLASNNFTGSLHPQWFEKFISMKKYNNTGETISHRHSISDGFYQDTVTISCKGFSMTFERILTTLTAIDLSDNALEGSIPESVGKLVSLHVLNLSHNAFSGRIPPQIGGITALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLEGKIPESRQFATFENSSYEGNAGLCGDPLPKCASWSPPSAEPHVESSSEHVDIVMFLFVGVGFGVGFAVGILMKTSWINRWFHSAVSRQRT


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
4-238 G3DSA:3.80.10.10

NKLINLVSLDLSKRYVNDNSDISFNESDDEIIFTGDSYNHLQESRLMSLVENLSNLKELYLDHVDMSTNVDDWCKTLAQSVPRLQVLSLDGCSLNTPIHHSLLRLHSLTVINLQSNPGIAVNLFPDFFMGFANLTVLRLSHNNLEGWFPDKFFQLKNLRILDLSFNMNLLGHLPKVPTSLETLRLEGTNFSYAKRISSSNFNMLKELGLEGKLISKDFLTSFGLIWSLCHLELLN

superfamily: SSF52047
6-294 SSF52047,LRR

LINLVSLDLSKRYVNDNSDISFNESDDEIIFTGDSYNHLQESRLMSLVENLSNLKELYLDHVDMSTNVDDWCKTLAQSVPRLQVLSLDGCSLNTPIHHSLLRLHSLTVINLQSNPGIAVNLFPDFFMGFANLTVLRLSHNNLEGWFPDKFFQLKNLRILDLSFNMNLLGHLPKVPTSLETLRLEGTNFSYAKRISSSNFNMLKELGLEGKLISKDFLTSFGLIWSLCHLELLNSELLGDSGSNLLSWIGAHKNLTCLILSEFDFSSTKPSSISNFKNLRSLWLFGCNLT

ProfileScan: PS51450
IPR001611
8-29 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVSLDLSKRYVNDNSDISFNE

HMMPanther: PTHR24420
12-1051 PTHR24420,FAMILY NOT NAMED

LDLSKRYVNDNSDISFNESDDEIIFTGDSYNHLQESRLMSLVENLSNLKELYLDHVDMSTNVDDWCKTLAQSVPRLQVLSLDGCSLNTPIHHSLLRLHSLTVINLQSNPGIAVNLFPDFFMGFANLTVLRLSHNNLEGWFPDKFFQLKNLRILDLSFNMNLLGHLPKVPTSLETLRLEGTNFSYAKRISSSNFNMLKELGLEGKLISKDFLTSFGLIWSLCHLELLNSELLGDSGSNLLSWIGAHKNLTCLILSEFDFSSTKPSSISNFKNLRSLWLFGCNLTRPIMSAIGDLVDLQSLDMSNCNTYSSMPSSIGNLTNLKSLYINSPGFLGPMPAAIGNLKSLKSMVFSNCEFTGPMPSTIGNLTKLQTLEIAACRFSGPIPYSIGQLKELRALFIEGCNMSGRIPNSIVNMSKLIYLGLPANYLSGKIPARLFTLPALLFLDLFGNHFSGPIQEFDAVPSYLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLRDLNLSHNNLSVIMDDEGDNSSSTYLSELKELGLACCNITKFPSILTRLSDMSYLDLSCNKISGNIPKWIWEKWSSSVVHLNLSHNMLTSMEVASYLLPFNRHFETLDLSSNMLQGQIPIPNLSAEFLDYSHNAFSSILPNFTLYLSKTWYLSMSKNNISGNIPHSICNSSLLVLNLAHNNFSGPFPSCLMEQTYFRNILNLRGNHFEGMLPTNVTRCAFQTIDLNGNKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRLYGSIGYTFEDKSGDHFPNLQIIDLASNNFTGSLHPQWFEKFISMKKYNNTGETISHRHSISDGFYQDTVTISCKGFSMTFERILTTLTAIDLSDNALEGSIPESVGKLVSLHVLNLSHNAFSGRIPPQIGGITALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLEGKIPESRQFATFENSSYEGNAGLCGDPLPKCASWSPPSAEPHVESSSEHVDIVMFLFVGVGFGVGFAVGILMKTSWINR

HMMPanther: PTHR24420:SF904
12-1051 PTHR24420:SF904

LDLSKRYVNDNSDISFNESDDEIIFTGDSYNHLQESRLMSLVENLSNLKELYLDHVDMSTNVDDWCKTLAQSVPRLQVLSLDGCSLNTPIHHSLLRLHSLTVINLQSNPGIAVNLFPDFFMGFANLTVLRLSHNNLEGWFPDKFFQLKNLRILDLSFNMNLLGHLPKVPTSLETLRLEGTNFSYAKRISSSNFNMLKELGLEGKLISKDFLTSFGLIWSLCHLELLNSELLGDSGSNLLSWIGAHKNLTCLILSEFDFSSTKPSSISNFKNLRSLWLFGCNLTRPIMSAIGDLVDLQSLDMSNCNTYSSMPSSIGNLTNLKSLYINSPGFLGPMPAAIGNLKSLKSMVFSNCEFTGPMPSTIGNLTKLQTLEIAACRFSGPIPYSIGQLKELRALFIEGCNMSGRIPNSIVNMSKLIYLGLPANYLSGKIPARLFTLPALLFLDLFGNHFSGPIQEFDAVPSYLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLRDLNLSHNNLSVIMDDEGDNSSSTYLSELKELGLACCNITKFPSILTRLSDMSYLDLSCNKISGNIPKWIWEKWSSSVVHLNLSHNMLTSMEVASYLLPFNRHFETLDLSSNMLQGQIPIPNLSAEFLDYSHNAFSSILPNFTLYLSKTWYLSMSKNNISGNIPHSICNSSLLVLNLAHNNFSGPFPSCLMEQTYFRNILNLRGNHFEGMLPTNVTRCAFQTIDLNGNKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRLYGSIGYTFEDKSGDHFPNLQIIDLASNNFTGSLHPQWFEKFISMKKYNNTGETISHRHSISDGFYQDTVTISCKGFSMTFERILTTLTAIDLSDNALEGSIPESVGKLVSLHVLNLSHNAFSGRIPPQIGGITALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLEGKIPESRQFATFENSSYEGNAGLCGDPLPKCASWSPPSAEPHVESSSEHVDIVMFLFVGVGFGVGFAVGILMKTSWINR

HMMPfam: PF00560
IPR001611
136-156 LRR_1
Leucine-rich repeat

NLTVLRLSHNNLEGWFPDKFF

ProfileScan: PS51450
IPR001611
136-157 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTVLRLSHNNLEGWFPDKFFQ

ProfileScan: PS51450
IPR001611
160-183 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRILDLSFNMNLLGHLPKVPTSL

HMMPfam: PF00560
IPR001611
160-178 LRR_1
Leucine-rich repeat

NLRILDLSFNMNLLGHLPK

Gene3D: G3DSA:3.80.10.10
280-525 G3DSA:3.80.10.10

FKNLRSLWLFGCNLTRPIMSAIGDLVDLQSLDMSNCNTYSSMPSSIGNLTNLKSLYINSPGFLGPMPAAIGNLKSLKSMVFSNCEFTGPMPSTIGNLTKLQTLEIAACRFSGPIPYSIGQLKELRALFIEGCNMSGRIPNSIVNMSKLIYLGLPANYLSGKIPARLFTLPALLFLDLFGNHFSGPIQEFDAVPSYLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLR

superfamily: SSF52047
296-596 SSF52047,LRR

PIMSAIGDLVDLQSLDMSNCNTYSSMPSSIGNLTNLKSLYINSPGFLGPMPAAIGNLKSLKSMVFSNCEFTGPMPSTIGNLTKLQTLEIAACRFSGPIPYSIGQLKELRALFIEGCNMSGRIPNSIVNMSKLIYLGLPANYLSGKIPARLFTLPALLFLDLFGNHFSGPIQEFDAVPSYLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLRDLNLSHNNLSVIMDDEGDNSSSTYLSELKELGLACCNITKFPSILTRLSDMSYLDLSCNKISGNIPKWIWE

ProfileScan: PS51450
IPR001611
306-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLQSLDMSNCNTYSSMPSSIGNL

HMMPfam: PF13855
474-534 LRR_8,Leucine rich repeat

YLMSLQLTSNELTGEFPKSFFELTSLIALEIDLNNLAGSVDLSSFKRLKKLRDLNLSHNNL

ProfileScan: PS51450
IPR001611
523-544 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRDLNLSHNNLSVIMDDEGDN

Gene3D: G3DSA:3.80.10.10
526-636 G3DSA:3.80.10.10

DLNLSHNNLSVIMDDEGDNSSSTYLSELKELGLACCNITKFPSILTRLSDMSYLDLSCNKISGNIPKWIWEKWSSSVVHLNLSHNMLTSMEVASYLLPFNRHFETLDLSSN

ProfileScan: PS51450
IPR001611
552-573 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELKELGLACCNITKFPSILTRL

ProfileScan: PS51450
IPR001611
575-597 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DMSYLDLSCNKISGNIPKWIWEK

HMMPfam: PF00560
IPR001611
578-593 LRR_1
Leucine-rich repeat

YLDLSCNKISGNIPKW

ProfileScan: PS51450
IPR001611
601-622 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SVVHLNLSHNMLTSMEVASYLL

superfamily: SSF52047
604-989 SSF52047,LRR

HLNLSHNMLTSMEVASYLLPFNRHFETLDLSSNMLQGQIPIPNLSAEFLDYSHNAFSSILPNFTLYLSKTWYLSMSKNNISGNIPHSICNSSLLVLNLAHNNFSGPFPSCLMEQTYFRNILNLRGNHFEGMLPTNVTRCAFQTIDLNGNKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRLYGSIGYTFEDKSGDHFPNLQIIDLASNNFTGSLHPQWFEKFISMKKYNNTGETISHRHSISDGFYQDTVTISCKGFSMTFERILTTLTAIDLSDNALEGSIPESVGKLVSLHVLNLSHNAFSGRIPPQIGGITALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLEGKIPESRQFATFENSSY

ProfileScan: PS51450
IPR001611
627-648 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HFETLDLSSNMLQGQIPIPNLS

Gene3D: G3DSA:3.80.10.10
637-740 G3DSA:3.80.10.10

MLQGQIPIPNLSAEFLDYSHNAFSSILPNFTLYLSKTWYLSMSKNNISGNIPHSICNSSLLVLNLAHNNFSGPFPSCLMEQTYFRNILNLRGNHFEGMLPTNVT

ProfileScan: PS51450
IPR001611
695-716 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLVLNLAHNNFSGPFPSCLME

HMMPfam: PF13855
745-802 LRR_8,Leucine rich repeat

QTIDLNGNKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRL

Gene3D: G3DSA:3.80.10.10
746-999 G3DSA:3.80.10.10

TIDLNGNKIEGRLPRALGNCTYLEVLDLGNNKIADTFPSWLGSLSNLRVLVLRSNRLYGSIGYTFEDKSGDHFPNLQIIDLASNNFTGSLHPQWFEKFISMKKYNNTGETISHRHSISDGFYQDTVTISCKGFSMTFERILTTLTAIDLSDNALEGSIPESVGKLVSLHVLNLSHNAFSGRIPPQIGGITALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLEGKIPESRQFATFENSSYEGNAGLCGDP

ProfileScan: PS51450
IPR001611
767-790 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLEVLDLGNNKIADTFPSWLGSLS

ProfileScan: PS51450
IPR001611
791-812 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRVLVLRSNRLYGSIGYTFED

ProfileScan: PS51450
IPR001611
820-842 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQIIDLASNNFTGSLHPQWFEK

HMMPfam: PF00560
IPR001611
820-842 LRR_1
Leucine-rich repeat

NLQIIDLASNNFTGSLHPQWFEK

ProfileScan: PS51450
IPR001611
888-910 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLTAIDLSDNALEGSIPESVGKL

ProfileScan: PS51450
IPR001611
912-934 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLHVLNLSHNAFSGRIPPQIGGI

HMMPfam: PF12799
936-972 LRR_4,Leucine Rich repeats (2 copies)

ALESLDLSSNWISGEIPQELTNLTFLTVLNLSNNQLE

ProfileScan: PS51450
IPR001611
936-959 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALESLDLSSNWISGEIPQELTNLT

ProfileScan: PS51450
IPR001611
960-982 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLTVLNLSNNQLEGKIPESRQFA


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox