PRGDB00048208 (P0439B06.36)

From PRG Wiki
Jump to: navigation, search
P0439B06.36
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13486627 (AP002882)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0439B06.

DNA Sequence

GTGGCCTCAAGGGACTCCTCAAGATGGACCTCAGCAACAACCTGCTGCAGGGTAGCTTGCCGCCGGAGCTCGCCGGGCTCGGGAGCCTGACATTGCTTGACCTCAGGAACAACAGCTTCACCGGCGGTTTGCCGTCCTTCTTGCAAGGCATGGCGTCGCTGCAGGACCTGCTCCTGTCGAACAACCCGCTGGGAGGCAGCCTGGGGCAGCTCGGGTGGGAGAGGCTGCGCGGCCTCGCGACGCTGGACCTGTCCAACCTCGGCCTCGTCGGAGCCATACCGGAATCCATGGCGGCACTGACCAGGCTGAGGTTCTTGGCGCTCGACCACAACCGGCTCACCGGCGACGTGCCGGCCAGGCTCGCCGAGCTGCCCAACATCGGCGCGCTGTACCTGAACGGGAACAACCTGACGGGGACGCTGCAGTTCTCGCCGGCGTTCTACCAGAGGATGGGGAGGAGGTTCGCGTCGTGGGACAACCCGGGCTTGTGCTACAGCAATGCCGCGGTGGACGCGGCGCACGCGCCGCCGGGGGTGACGGTGTGCAAGGTGGCCGGCGGCGTGGGGGACGGGAGGAAGCCGGAGGCGAGCTCCAGCCTCATGGCCACCTCGTCTGCTTCCAACCTCATCAATGGCTTCTGCTTCTTCTTGTGGATGGTGGCCACGTCTCTCTTGTAGGGAGTGTCATGTGATCTGTTCAATGGGCTGTGGTACCCAACAGTGATGAGCATTGGCCCAGTTCTTGACAACTCACTGCGGTGCTCTGCTGATGCCAAGTTCAGTCCCCAGCTGTTCGACCTCAAGCGCCTCAAGACCCTCTCCTTCTACAGCTGCTTCCCGGCGACCAACCCGACTCCCATTCCGGCCACCAGCTGGGACAAGCTCGCCGGCAGCCTGGAGACGCTCGAGTTCCGCACCAACCCTGGCCTGACGGGGCCCATACCGGCGTCGCTCGGCCGCCTGTCGAGCCTCCAGTCGCTGGTGTTCGTCGAGAACAACCTCACCGGTGCCGTGCCCGCCGAGCTCGGGTCTCTGGTGCGGCTGCGTCGGCTCGTCCTGTCCGGGAACGGGCTGTCCGGGCAGATCCCGGCGTCACTTGATGAGGCAACCACAGAGCAGAAAGCTCCTGCAGCTGCAGGCTCTTTCTCTGCTGCTCTTCATCATCGCCCTGCACAGCCGCCTCCATGGCTGCTCGGGCCAAGGTGAGGCGGCGGACGGCTCGGCGTCCACGGCGGCGGCTCCAATGGAGGAGAAGGAGAAGAGGGCTCTCTACGCGGCCATCGAGGGATTCGTCGGCAAGGGCTGGAATGGCTCCGCCCTCTATCCTGACCCCTGCGGCTGGTCTCCCATTCAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MRQPQSRKLLQLQALSLLLFIIALHSRLHGCSGQGEAADGSASTAAAPMEEKEKRALYAAIEGFVGKGWNGSALYPDPCGWSPIQGVSCDLFNGLWYPTVMSIGPVLDNSLRCSADAKFSPQLFDLKRLKTLSFYSCFPATNPTPIPATSWDKLAGSLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGTLQFSPAFYQRMGRRFASWDNPGLCYSNAAVDAAHAPPGVTVCKVAGGVGDGRKPEASSSLMATSSASNLINGFCFFLWMVATSLL

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
47-392 SSF52058,LRR

APMEEKEKRALYAAIEGFVGKGWNGSALYPDPCGWSPIQGVSCDLFNGLWYPTVMSIGPVLDNSLRCSADAKFSPQLFDLKRLKTLSFYSCFPATNPTPIPATSWDKLAGSLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGTLQFSPAFYQRMGRRFASWDNPGLCYSN

Gene3D: G3DSA:3.80.10.10
84-91 G3DSA:3.80.10.10

IQGVSCDL

Gene3D: G3DSA:3.80.10.10
123-365 G3DSA:3.80.10.10

LFDLKRLKTLSFYSCFPATNPTPIPATSWDKLAGSLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGT

HMMPanther: PTHR24420
157-366 PTHR24420,FAMILY NOT NAMED

SLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGTL

HMMPfam: PF13855
206-264 LRR_8,Leucine rich repeat

RLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNS

HMMPfam: PF13504
326-340 LRR_7,Leucine rich repeat

TRLRFLALDHNRLTG


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox