PRGDB00048208 (P0439B06.36)

From PRG Wiki
Jump to: navigation, search
P0439B06.36
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13486627 (AP002882)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0439B06.

DNA Sequence

GTGGCCTCAAGGGACTCCTCAAGATGGACCTCAGCAACAACCTGCTGCAGGGTAGCTTGCCGCCGGAGCTCGCCGGGCTCGGGAGCCTGACATTGCTTGACCTCAGGAACAACAGCTTCACCGGCGGTTTGCCGTCCTTCTTGCAAGGCATGGCGTCGCTGCAGGACCTGCTCCTGTCGAACAACCCGCTGGGAGGCAGCCTGGGGCAGCTCGGGTGGGAGAGGCTGCGCGGCCTCGCGACGCTGGACCTGTCCAACCTCGGCCTCGTCGGAGCCATACCGGAATCCATGGCGGCACTGACCAGGCTGAGGTTCTTGGCGCTCGACCACAACCGGCTCACCGGCGACGTGCCGGCCAGGCTCGCCGAGCTGCCCAACATCGGCGCGCTGTACCTGAACGGGAACAACCTGACGGGGACGCTGCAGTTCTCGCCGGCGTTCTACCAGAGGATGGGGAGGAGGTTCGCGTCGTGGGACAACCCGGGCTTGTGCTACAGCAATGCCGCGGTGGACGCGGCGCACGCGCCGCCGGGGGTGACGGTGTGCAAGGTGGCCGGCGGCGTGGGGGACGGGAGGAAGCCGGAGGCGAGCTCCAGCCTCATGGCCACCTCGTCTGCTTCCAACCTCATCAATGGCTTCTGCTTCTTCTTGTGGATGGTGGCCACGTCTCTCTTGTAGGGAGTGTCATGTGATCTGTTCAATGGGCTGTGGTACCCAACAGTGATGAGCATTGGCCCAGTTCTTGACAACTCACTGCGGTGCTCTGCTGATGCCAAGTTCAGTCCCCAGCTGTTCGACCTCAAGCGCCTCAAGACCCTCTCCTTCTACAGCTGCTTCCCGGCGACCAACCCGACTCCCATTCCGGCCACCAGCTGGGACAAGCTCGCCGGCAGCCTGGAGACGCTCGAGTTCCGCACCAACCCTGGCCTGACGGGGCCCATACCGGCGTCGCTCGGCCGCCTGTCGAGCCTCCAGTCGCTGGTGTTCGTCGAGAACAACCTCACCGGTGCCGTGCCCGCCGAGCTCGGGTCTCTGGTGCGGCTGCGTCGGCTCGTCCTGTCCGGGAACGGGCTGTCCGGGCAGATCCCGGCGTCACTTGATGAGGCAACCACAGAGCAGAAAGCTCCTGCAGCTGCAGGCTCTTTCTCTGCTGCTCTTCATCATCGCCCTGCACAGCCGCCTCCATGGCTGCTCGGGCCAAGGTGAGGCGGCGGACGGCTCGGCGTCCACGGCGGCGGCTCCAATGGAGGAGAAGGAGAAGAGGGCTCTCTACGCGGCCATCGAGGGATTCGTCGGCAAGGGCTGGAATGGCTCCGCCCTCTATCCTGACCCCTGCGGCTGGTCTCCCATTCAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MRQPQSRKLLQLQALSLLLFIIALHSRLHGCSGQGEAADGSASTAAAPMEEKEKRALYAAIEGFVGKGWNGSALYPDPCGWSPIQGVSCDLFNGLWYPTVMSIGPVLDNSLRCSADAKFSPQLFDLKRLKTLSFYSCFPATNPTPIPATSWDKLAGSLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGTLQFSPAFYQRMGRRFASWDNPGLCYSNAAVDAAHAPPGVTVCKVAGGVGDGRKPEASSSLMATSSASNLINGFCFFLWMVATSLL

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
47-392 SSF52058,LRR

APMEEKEKRALYAAIEGFVGKGWNGSALYPDPCGWSPIQGVSCDLFNGLWYPTVMSIGPVLDNSLRCSADAKFSPQLFDLKRLKTLSFYSCFPATNPTPIPATSWDKLAGSLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGTLQFSPAFYQRMGRRFASWDNPGLCYSN

Gene3D: G3DSA:3.80.10.10
84-91 G3DSA:3.80.10.10

IQGVSCDL

Gene3D: G3DSA:3.80.10.10
123-365 G3DSA:3.80.10.10

LFDLKRLKTLSFYSCFPATNPTPIPATSWDKLAGSLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGT

HMMPanther: PTHR24420
157-366 PTHR24420,FAMILY NOT NAMED

SLETLEFRTNPGLTGPIPASLGRLSSLQSLVFVENNLTGAVPAELGSLVRLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNSFTGGLPSFLQGMASLQDLLLSNNPLGGSLGQLGWERLRGLATLDLSNLGLVGAIPESMAALTRLRFLALDHNRLTGDVPARLAELPNIGALYLNGNNLTGTL

HMMPfam: PF13855
206-264 LRR_8,Leucine rich repeat

RLRRLVLSGNGLSGQIPASLGGLKGLLKMDLSNNLLQGSLPPELAGLGSLTLLDLRNNS

HMMPfam: PF13504
326-340 LRR_7,Leucine rich repeat

TRLRFLALDHNRLTG


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox