PRGDB00048215 (B1047H05.56)

From PRG Wiki
Jump to: navigation, search
B1047H05.56
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50726539 (AP005966)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:B1047H05.

DNA Sequence

ATGGCGCCTTTGGGCTCCCACAGCATCCCTGTTCTGGTCACAATCTTATTGGCATGCTTCTCATTCTTTCTCATCACTGCATTCTCCCTAGTTCCCACTGCACCACTCCATGATGCATCAGATACTACCGATTTTCAGGCTCTGCTTTGCCTCAAGCTCCATCTCAATGACAATGCCGGAGTCATGGCTTCCTGGAGAAATGATTCTTCGCAATACTGTCAATGGCCCGGTGTCACTTGTAGCAAGAGCCACACATCTCGAGTCACTGAATTGAACCTAGAGTCATCCAACCTCCATGGCCAAATACCACCTTGCATTGGTAATCTTACTTTCTTGACAATAATCCACCTTCCATTTAATCAGTTGACTGGCAACATTCCACCTGAAATTGGTCATTTGCGTCGCCTCACCTACCTGAACCTCACCTCTAATGGCCTCACTGGCACGATACCAGAGGCTCTGTCTTCATGCTCTAACCTTCAGATCATTGATATCTCAAATAACTCGATTGATGGTGAGATCCCCTCAAGCATGAACAAATGCTCAAATCTTCAAGCTATCTGCTTGTTTGACAATAAACTTCAAGGAGTAATCCCAGAAGGATTAGGTACACTCTCCAACCTTTCAGTTTTATATCTTTCAAATAACAACCTAAGCGGCAATATTCCTTTCTCACTTGGAAGTAACTCTTTTCTGAATGTGGTCATTCTCACAAATAACAGCCTCACTGGAGGCATCCCACCTCTCCTAGCTAATAGTTCATCACTCATATTGCTTGATTTAACTAATAATCGTCTTGGCGGCGAGATTCCTTTTGCTCTTTTTAATAGCTCGTCACTTAATCTCATAAGCCTTGCAGTTAATAACTTTGTTGGGTCTATCCCACCAATCTCAAATATCTCCTCACCACTGTGGTATCTCAGCTTATCCCAAAACAATCTCTCAGGTAGCATACCTTCCTCTATAGAAAACCTCTCCTCCCTTGAAATACTCTACCTTTCACAGAACAACTTCCAGGGAACCATTCCATCTAGTTTAAGCAGAATACCAAACTTGCAAGAACTGGACTTGACATATAACAACTTGTCAGGGACAGTTCCGGCTTCTCTGTACAACATGTCTAATCTCGTATACCTTGGCATGGGCACTAATAAACTCATTGGAGAAATTCCAGATAACATAGGATATACCCTTCCAAATATCAAAACACTGATCTTGCAAGGAAATCAATTCCAAGGGCAGATCCCCACTTCACTAGGCATTGCAAAAAATCTCCAAGTGATTAATCTTCGTGACAATGCATTCCATGGTATTATTCCTTCTTTTGGGAACCTGCCTGACTTGATGGAATTGAATCTCGGGATGAATCGACTAGAAGCTGGAGACTGGTCTTTCTTATCCTCATTGATAACTAGTAGACAGTTGGTTCAATTATGCCTGGACAAAAACATCCTCAAAGGAACCCTACCAAGTTCCATCGCAAAACTTTCAACAAGCTTACAGGTGTTGCTGCTAACAGGAAATGAAATATCCGGTACCATACCTCAAGAGATAGAGAAACTCACAAGCCTTACGCTTCTTTATATGGAAAAAAATCTACTTACTGGAAATCTTCCAGATTCACTTGGAAATCTGCTAAACTTGTTTATCCTAAGCTTATCCCAAAACAAAATTTCAGGACAAATTCCAACTTCATTTGGTAATCTAAGTCATCTAAGTGAGCTCTACTTACAGGAAAATAATTTGAGTGGACCGATTCCTAGCTCCTTAGGGAGTTGCAAGAATCTAGAAGCTTTAAACCTGTCTTGTAACAGCTTTGATAGTAGCATACCAGAGGAACTCGTTACTCTTTCCTCTCTTTCTGAATGGTTGGACTTGTCTCACAACCAACTCGATGGAGAAATACCATCAGAGATTGGTGGCTCGATCAATCTTGATATTCTAAATATTTCCAATAACCGACTGTCAGGACAAATTCCCTCTGCTCTTGGCGACTGTGTCCACTTAAGCTCTCTCCGTATGGAAGGGAACCTTCTTGATGGACGAATTCCTGATTCTTTCATAAATTTAAGAGGCATTGTTGAGTTAGATCTTTCTCAGAACAATCTATCTGGTAAAATACCTGAATTCATGGAATCCTTTGGGTCCATGAAGCTTCTCAATTTGTCCTTCAATGATTTTGAAGGACAGGTACCAACTGAAGGGATATTTCAGAATGCAAGTGAGGTTTTTATCCAAGGGAACAAGAAGTTATGTGGTACATATCCATTGCTACAGTTACCACTCTGCAATGTAAAGCCATCAAAGGGAAAGCACACCAATAAAATACTTAAGATAGTAGGACCTATAGCTATTTGTCTGGCTCTAACATCATGTTTAGCGCTCATTCTACTGAAGAAGAGGAATAAAGTCAAGCAAGCATCTGATCCTTCCTGTAAGGAGTTGAAGACGTTTACATATTCAACATTGAAGAAGATACCGAGAATAATTGTGACCCTGAAAATCATGTCATGA


Protein sequences

Name Description Sequence
putative disease resistance protein Cf-2.1 putative disease resistance protein Cf-2.1 [Oryza sativa Japonica Group].

MAPLGSHSIPVLVTILLACFSFFLITAFSLVPTAPLHDASDTTDFQALLCLKLHLNDNAGVMASWRNDSSQYCQWPGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNISSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQVINLRDNAFHGIIPSFGNLPDLMELNLGMNRLEAGDWSFLSSLITSRQLVQLCLDKNILKGTLPSSIAKLSTSLQVLLLTGNEISGTIPQEIEKLTSLTLLYMEKNLLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALNLSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLSSLRMEGNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFNDFEGQVPTEGIFQNASEVFIQGNKKLCGTYPLLQLPLCNVKPSKGKHTNKILKIVGPIAICLALTSCLALILLKKRNKVKQASDPSCKELKTFTYSTLKKIPRIIVTLKIMS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
6-811 PTHR24420:SF474,SUBFAMILY NOT NAMED

SHSIPVLVTILLACFSFFLITAFSLVPTAPLHDASDTTDFQALLCLKLHLNDNAGVMASWRNDSSQYCQWPGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNISSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQVINLRDNAFHGIIPSFGNLPDLMELNLGMNRLEAGDWSFLSSLITSRQLVQLCLDKNILKGTLPSSIAKLSTSLQVLLLTGNEISGTIPQEIEKLTSLTLLYMEKNLLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALNLSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLSSLRMEGNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFNDFEGQVPTEGIFQNASEVFIQGNKKLCGTYPLLQLPLCNVKPSKGKHTNKILKIVGPIAICLALTSCLALILLKKRNKVKQASDPS

HMMPanther: PTHR24420
6-811 PTHR24420,FAMILY NOT NAMED

SHSIPVLVTILLACFSFFLITAFSLVPTAPLHDASDTTDFQALLCLKLHLNDNAGVMASWRNDSSQYCQWPGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNISSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQVINLRDNAFHGIIPSFGNLPDLMELNLGMNRLEAGDWSFLSSLITSRQLVQLCLDKNILKGTLPSSIAKLSTSLQVLLLTGNEISGTIPQEIEKLTSLTLLYMEKNLLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALNLSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLSSLRMEGNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFNDFEGQVPTEGIFQNASEVFIQGNKKLCGTYPLLQLPLCNVKPSKGKHTNKILKIVGPIAICLALTSCLALILLKKRNKVKQASDPS

HMMPfam: PF08263
IPR013210
43-81 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TDFQALLCLKLHLNDNAGVMASWRNDSSQYCQWPGVTCS

Gene3D: G3DSA:3.80.10.10
44-290 G3DSA:3.80.10.10

DFQALLCLKLHLNDNAGVMASWRNDSSQYCQWPGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNF

superfamily: SSF52047
90-412 SSF52047,LRR

ELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNIPPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAVNNFVGSIPPISNISSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQ

HMMPfam: PF13855
135-194 LRR_8,Leucine rich repeat

RLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQAICLFDNKL

HMMPfam: PF00560
IPR001611
207-228 LRR_1
Leucine-rich repeat

NLSVLYLSNNNLSGNIPFSLGS

Gene3D: G3DSA:3.80.10.10
291-485 G3DSA:3.80.10.10

VGSIPPISNISSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQVINLRDNAFHGIIPSFGNLPDLMELNLGMNRLEAGDWSFLSSLITSRQLVQLCLDKNIL

HMMPfam: PF13855
305-362 LRR_8,Leucine rich repeat

WYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNL

superfamily: SSF52058
415-535 SSF52058,LRR

IPTSLGIAKNLQVINLRDNAFHGIIPSFGNLPDLMELNLGMNRLEAGDWSFLSSLITSRQLVQLCLDKNILKGTLPSSIAKLSTSLQVLLLTGNEISGTIPQEIEKLTSLTLLYMEKNLLT

Gene3D: G3DSA:3.80.10.10
486-753 G3DSA:3.80.10.10

KGTLPSSIAKLSTSLQVLLLTGNEISGTIPQEIEKLTSLTLLYMEKNLLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALNLSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLSSLRMEGNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFNDFEGQVPTEGIFQNASEVFIQGNKKLCG

superfamily: SSF52058
498-753 SSF52058,LRR

TSLQVLLLTGNEISGTIPQEIEKLTSLTLLYMEKNLLTGNLPDSLGNLLNLFILSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALNLSCNSFDSSIPEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLSSLRMEGNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFNDFEGQVPTEGIFQNASEVFIQGNKKLCG

HMMPfam: PF00560
IPR001611
547-569 LRR_1
Leucine-rich repeat

NLFILSLSQNKISGQIPTSFGNL

HMMPfam: PF00560
IPR001611
571-593 LRR_1
Leucine-rich repeat

HLSELYLQENNLSGPIPSSLGSC

HMMPfam: PF00560
IPR001611
595-614 LRR_1
Leucine-rich repeat

NLEALNLSCNSFDSSIPEEL

HMMPfam: PF13516
619-640 LRR_6,Leucine Rich repeat

SLSEWLDLSHNQLDGEIPSEIG

HMMPfam: PF00560
IPR001611
644-664 LRR_1
Leucine-rich repeat

NLDILNISNNRLSGQIPSALG

HMMPfam: PF00560
IPR001611
694-710 LRR_1
Leucine-rich repeat

VELDLSQNNLSGKIPEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox