PRGDB00048220 (OJ1705_E12.51)

From PRG Wiki
Jump to: navigation, search
OJ1705_E12.51
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50251763 (AP004070)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1705_E12.

DNA Sequence

ATGGTGGGAGGCAGCCGTCTGTTCCTCCTCCTCCTCCTACCTTTGCTGCTGCTGCTGCTGGGCGCCGGCTGCAGAGATGGCCGCCGGTGCGCCGCCGCGGCCGCGCAGACTCAGAGGCTGCCGCAGCAAGAAGTTGAAGCACTTAAGGGAATAGCACGCAAGCTTAACAAGATGGATTGGGACTTCAGTGTGGATCCATGCACTGGGTCTAAAACTTGGGTTAATGCCAGTGATTCCAATAGTTACCCAAAATCTAGTTATCCTAATTTTCCAGTCAGCAATCTGACATGTGATTGTTCATTCAAGAACAACACAGAGTGTCATGTTATCAGCTTGGAACTTATGCGTCAGAATCTTAGTGGAGTTCTACCTGAAGAAGTTGTCAACCTCACTTATTTGACAAATCTTGACTTATCACGCAATTTCATCCAAGGACCAATTCCAGCATCATGGGCTAGCCTACCTGTTTTTAATCTGTCTCTCCAGGGAAATCGCATATCTGGAACAGTACCTAAGGAGCTTGGACGCATGCCCTTCTTGAAATCTATAAATCTAGAAGGCAATCAGCTTGAGGGTCATATTCCACCAGAATTCGGTAACATCATCAGTTTGGAGAGATTTTTCATTTCTGCAAATGACATCACAGGAGAGTTGCCTTCAACCTTTTCCAGGCTCACAAATATGACAGATTTCCGAATTGACGGGACCAATATCTCAGGAAGAATACCCAGTTTCATAAAAAATTGGCAACGGGTCAACAGAATAGACATGCAGGGTACCTTGATGAGTGGGCCTATTCCTCCAGAAATTTCTTTGTTGAACAACTTAACAGAACTGAGAGTGACTGATTTGAGTGGACCGAGCATGAAATTTCCTCCCTTACAAAATGCACAGCACCTTACAAAAGTGGTCCTAAGAAACTGCTCCATATATGGTGAAATACCACCTTACCTTGGACAGATGCAGTATCTAATACTCATGGATCTAAGCTTCAACAAGTTGACTGGTCAAATTCCACAAAATTTTGACAGAATGGTGGCACTACAACTACAATATTTGTACTTAAGTGACAACATGCTGACTGGAGATTTGCCTGGTTGGATGTTGAAAAACAAGGCAAGCAACAAAGTAAACATGGATGTGTCGTTTAATAACTTCACGGGTAACCCTCCAAATGAATGTCAACAAGCAAACGTAAATATGGTTTCAAGTTTTTCATCCTCAAATGACAATCTTTTGCAACCATGTTTACGAAAGAATCTTCCCTGCATGGACAAACCACGCTATTCCTCCCTATTTATTAACTGTGGTGGCAAAAGTGTTGAGGTCAATGGGAATATTTATGAGGATGACTCATCTCGAATAGGAACATCAACTTTTGTTTTATCAAATGACAGAAAATGGGCCTATAGTAGTACAGGAGATTTTGTGGGTAATCCAGATGCTGATTACATTGCTAGAAACACATCAGAACTCACACTGGATCACCCTGAGTTATACACTGAAGCTCGCCTCTCACCCCTCTCACTGAAATACTATGGAGTCTGCATGGAAAATGGTGAATATTCTGTAGAACTTCATTTTGCTGAGATTGTGTTTACAGAAGATCATACTTTTTCCAGCAATGGCAAGCGCATTTTTGATGTTTTTATCCAGGGTACTAAAGTTTTGAAGGATTTTAACATTCAAGATGAGGCTGGTGGTGTCCATCGTGTAATTACAAAAACTTTCACAACCAACATCACAGATAATACATTGGAAATTCACTTCTACTGGGCAGGCAAAGGTACCACAGGTGTTCCTGACCGGGGTGTGTATGGTCCATTGATCTCAGCTATATCTGTGATACAATTAAACAGGAACCATCATGGAATCTCTACTGGATTGATGATTACTATAATAGTAGCAGCATGTTTGATTGTCATACTTGCGCTAATTCTTTGCTATATCAAATTCTTCCGGAAAAAGAATCTGAAAGGAAATGGTTTACAATTCTTTTACCATGGAAGGAAGACCGATACTTCAGATCTTCAGACACGGACACAGTACTTCTTTAGCTTAAAAGAAATTGAATCTGCAACGAAAAATTTTGATCCTGCAAATAAAATTGGTGAGGGTGGCTTTGGACCTGTTTACAAGGACGTGGAGATCATCAATTGA


Protein sequences

Name Description Sequence
disease resistance protein Cf-2.1-like disease resistance protein Cf-2.1-like [Oryza sativa Japonica Group].

MVGGSRLFLLLLLPLLLLLLGAGCRDGRRCAAAAAQTQRLPQQEVEALKGIARKLNKMDWDFSVDPCTGSKTWVNASDSNSYPKSSYPNFPVSNLTCDCSFKNNTECHVISLELMRQNLSGVLPEEVVNLTYLTNLDLSRNFIQGPIPASWASLPVFNLSLQGNRISGTVPKELGRMPFLKSINLEGNQLEGHIPPEFGNIISLERFFISANDITGELPSTFSRLTNMTDFRIDGTNISGRIPSFIKNWQRVNRIDMQGTLMSGPIPPEISLLNNLTELRVTDLSGPSMKFPPLQNAQHLTKVVLRNCSIYGEIPPYLGQMQYLILMDLSFNKLTGQIPQNFDRMVALQLQYLYLSDNMLTGDLPGWMLKNKASNKVNMDVSFNNFTGNPPNECQQANVNMVSSFSSSNDNLLQPCLRKNLPCMDKPRYSSLFINCGGKSVEVNGNIYEDDSSRIGTSTFVLSNDRKWAYSSTGDFVGNPDADYIARNTSELTLDHPELYTEARLSPLSLKYYGVCMENGEYSVELHFAEIVFTEDHTFSSNGKRIFDVFIQGTKVLKDFNIQDEAGGVHRVITKTFTTNITDNTLEIHFYWAGKGTTGVPDRGVYGPLISAISVIQLNRNHHGISTGLMITIIVAACLIVILALILCYIKFFRKKNLKGNGLQFFYHGRKTDTSDLQTRTQYFFSLKEIESATKNFDPANKIGEGGFGPVYKDVEIIN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-718 PTHR24420,FAMILY NOT NAMED

MVGGSRLFLLLLLPLLLLLLGAGCRDGRRCAAAAAQTQRLPQQEVEALKGIARKLNKMDWDFSVDPCTGSKTWVNASDSNSYPKSSYPNFPVSNLTCDCSFKNNTECHVISLELMRQNLSGVLPEEVVNLTYLTNLDLSRNFIQGPIPASWASLPVFNLSLQGNRISGTVPKELGRMPFLKSINLEGNQLEGHIPPEFGNIISLERFFISANDITGELPSTFSRLTNMTDFRIDGTNISGRIPSFIKNWQRVNRIDMQGTLMSGPIPPEISLLNNLTELRVTDLSGPSMKFPPLQNAQHLTKVVLRNCSIYGEIPPYLGQMQYLILMDLSFNKLTGQIPQNFDRMVALQLQYLYLSDNMLTGDLPGWMLKNKASNKVNMDVSFNNFTGNPPNECQQANVNMVSSFSSSNDNLLQPCLRKNLPCMDKPRYSSLFINCGGKSVEVNGNIYEDDSSRIGTSTFVLSNDRKWAYSSTGDFVGNPDADYIARNTSELTLDHPELYTEARLSPLSLKYYGVCMENGEYSVELHFAEIVFTEDHTFSSNGKRIFDVFIQGTKVLKDFNIQDEAGGVHRVITKTFTTNITDNTLEIHFYWAGKGTTGVPDRGVYGPLISAISVIQLNRNHHGISTGLMITIIVAACLIVILALILCYIKFFRKKNLKGNGLQFFYHGRKTDTSDLQTRTQYFFSLKEIESATKNFDPANKIGEGGFGPVYKDVEII

HMMPanther: PTHR24420:SF512
1-718 PTHR24420:SF512

MVGGSRLFLLLLLPLLLLLLGAGCRDGRRCAAAAAQTQRLPQQEVEALKGIARKLNKMDWDFSVDPCTGSKTWVNASDSNSYPKSSYPNFPVSNLTCDCSFKNNTECHVISLELMRQNLSGVLPEEVVNLTYLTNLDLSRNFIQGPIPASWASLPVFNLSLQGNRISGTVPKELGRMPFLKSINLEGNQLEGHIPPEFGNIISLERFFISANDITGELPSTFSRLTNMTDFRIDGTNISGRIPSFIKNWQRVNRIDMQGTLMSGPIPPEISLLNNLTELRVTDLSGPSMKFPPLQNAQHLTKVVLRNCSIYGEIPPYLGQMQYLILMDLSFNKLTGQIPQNFDRMVALQLQYLYLSDNMLTGDLPGWMLKNKASNKVNMDVSFNNFTGNPPNECQQANVNMVSSFSSSNDNLLQPCLRKNLPCMDKPRYSSLFINCGGKSVEVNGNIYEDDSSRIGTSTFVLSNDRKWAYSSTGDFVGNPDADYIARNTSELTLDHPELYTEARLSPLSLKYYGVCMENGEYSVELHFAEIVFTEDHTFSSNGKRIFDVFIQGTKVLKDFNIQDEAGGVHRVITKTFTTNITDNTLEIHFYWAGKGTTGVPDRGVYGPLISAISVIQLNRNHHGISTGLMITIIVAACLIVILALILCYIKFFRKKNLKGNGLQFFYHGRKTDTSDLQTRTQYFFSLKEIESATKNFDPANKIGEGGFGPVYKDVEII

ProfileScan: PS51257
1-24 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MVGGSRLFLLLLLPLLLLLLGAGC

superfamily: SSF52058
65-370 SSF52058,LRR

DPCTGSKTWVNASDSNSYPKSSYPNFPVSNLTCDCSFKNNTECHVISLELMRQNLSGVLPEEVVNLTYLTNLDLSRNFIQGPIPASWASLPVFNLSLQGNRISGTVPKELGRMPFLKSINLEGNQLEGHIPPEFGNIISLERFFISANDITGELPSTFSRLTNMTDFRIDGTNISGRIPSFIKNWQRVNRIDMQGTLMSGPIPPEISLLNNLTELRVTDLSGPSMKFPPLQNAQHLTKVVLRNCSIYGEIPPYLGQMQYLILMDLSFNKLTGQIPQNFDRMVALQLQYLYLSDNMLTGDLPGWMLK

Gene3D: G3DSA:3.80.10.10
92-279 G3DSA:3.80.10.10

VSNLTCDCSFKNNTECHVISLELMRQNLSGVLPEEVVNLTYLTNLDLSRNFIQGPIPASWASLPVFNLSLQGNRISGTVPKELGRMPFLKSINLEGNQLEGHIPPEFGNIISLERFFISANDITGELPSTFSRLTNMTDFRIDGTNISGRIPSFIKNWQRVNRIDMQGTLMSGPIPPEISLLNNLTEL

HMMPfam: PF00560
IPR001611
133-153 LRR_1
Leucine-rich repeat

LTNLDLSRNFIQGPIPASWAS

HMMPfam: PF00560
IPR001611
180-200 LRR_1
Leucine-rich repeat

LKSINLEGNQLEGHIPPEFGN

Gene3D: G3DSA:3.80.10.10
280-400 G3DSA:3.80.10.10

RVTDLSGPSMKFPPLQNAQHLTKVVLRNCSIYGEIPPYLGQMQYLILMDLSFNKLTGQIPQNFDRMVALQLQYLYLSDNMLTGDLPGWMLKNKASNKVNMDVSFNNFTGNPPNECQQANVN

HMMPfam: PF00560
IPR001611
349-371 LRR_1
Leucine-rich repeat

QLQYLYLSDNMLTGDLPGWMLKN

HMMPfam: PF11721
IPR021720
431-613 Malectin
Malectin

SLFINCGGKSVEVNGNIYEDDSSRIGTSTFVLSNDRKWAYSSTGDFVGNPDADYIARNTSELTLDHPELYTEARLSPLSLKYYGVCMENGEYSVELHFAEIVFTEDHTFSSNGKRIFDVFIQGTKVLKDFNIQDEAGGVHRVITKTFTTNITDNTLEIHFYWAGKGTTGVPDRGVYGPLISAI

Gene3D: G3DSA:2.60.120.360
513-597 G3DSA:2.60.120.360

YGVCMENGEYSVELHFAEIVFTEDHTFSSNGKRIFDVFIQGTKVLKDFNIQDEAGGVHRVITKTFTTNITDNTLEIHFYWAGKGT

superfamily: SSF56112
IPR011009
669-713 Kinase_like
Protein kinase-like domain

GRKTDTSDLQTRTQYFFSLKEIESATKNFDPANKIGEGGFGPVYK

Gene3D: G3DSA:3.30.200.20
681-713 G3DSA:3.30.200.20

TQYFFSLKEIESATKNFDPANKIGEGGFGPVYK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox