PRGDB00048238 (OSJNBa0023I13.48)

From PRG Wiki
Jump to: navigation, search
OSJNBa0023I13.48
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 37806382 (AP006064)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0023I13.

DNA Sequence

ATGGCTCTCCGGTCACGAACACACGCATCAAAATCCATCATCCCCCTCCGCATCTCCCTTCTGCTTCTGCTGCTGTCGACGCCGCCGTGTTCCAGCTCGACGATCATCCAGCACGGCGAGGCAGAATCCCTCCTCCGGTGGAAATCCACCTTGTCGGCGGCGGCGTCAGCGTCTCCGCTGACCACATGGTCACCGGCGACCTCCAGCTCCGCCTGCTCGTCCTGGCGCGGCGTCACGTGCGACGCCGCCGGCCACGTCGCGGAGCTCAGCCTCCCCGGCGCAGGGCTCCACGGCGAGCTCCGCGCGCTCGACCTCGCCGCGTTCCCGGCGCTCGCGAAGCTCGACCTCCGCCGCAACAACATCACCGCCGGCGTCGTGGCAGCGAACGTCTCCACCAGGGCCAGCAACCTGACGTACCTTGACCTTTCCGACAACGCCTTCGCCGGCCACATACTGGACGTCTTGCCATTGTCGCCGGCGACGCTGCAACAGCTGAGCTACCTCAACCTGTCCTCCAATGGACTGTACGGTCCTATCCTGAGGTCGCTCTCCGCCATGGGGAAGATGACCGTGTTCGACGTGTCAAGAAACAGGCTTAACAGTGACATCCCTTCAGAATTGTTCACGAACTGGGTAGAACTCACACAATTCCGTGTTCAGAACAACTCGATCACCGGCAGCATCCCGCCGACGATCTGCAACACGACAAAGCTGAAGTATTTGCGCCTGGCGAAGAACAAGCTCACCGGCGAGATCCCGGCGGAGATCGGAAGGCTGGCAAGCTTGCAGGCACTGGAGCTAGCGGATAATTTCTTGACAGGGCCGATTCCAAATTCCGTGGGGAACCTGACAGACCTGTTGGTAATGGATCTCTTCTCCAACGGCTTCACAGGCGTGATACCACCGGAAATCTTCAACCTGACAGCGTTGCGAACCATCGACGTCGGCACGAATCGATTGGAGGGTGAGGTTCCTGCATCCATATCATCCCTCAGGAATCTCTATGGCCTTGATCTCAGCAATAACAGGTTCAGTGGCACTATACCAAGTGATTTTGGCAGTAGGCAATTTGTGACCATTGTGTTGGCCAGCAACAGCTTCTCGGGAGAATTTCCTTTGACATTTTGTCAGCTGGATTCTCTGGAAATCTTGGACCTGTCAAACAATCATCTCCATGGAGAGATCCCTAGTTGCCTATGGCACTTGCAGGACCTGGTATTCATGGATTTGTCATACAACTCCTTTTCTGGGGAGGTTCCTCCGATGTCGGCTTACCCTAATTCATCATTGGAATCGGTGCATCTTGCTAACAACAACCTCACTGGGGGATATCCAATGGTCCTAAAGGGATGCAAGTGGCTAATAATTCTAGATCTTGGTGGCAACCATTTTACTGGCACAATTCCCTCATGGATTGGAACTTGCAATCCCTTACTGAGGTTTCTCATTCTGCGATCTAATGTGTTCAATGGGAGTATCCCGAAGGAACTATCACAACTCTCCCATCTTCAATTGTTGGACCTAGCTATGAACAATTTAGTAGGTTCGATACCGAGAAGTTTTGGAAATTTTACATCCATGATACAACCAAAAACTGAACTGAACTTGCCTTGGAAAGTCCAACACCACATTTTGGATGGGCGTGTTGATTACACATACACAGACCGAATTGGCATAAACTGGAAGAGGCAAAACCAAACTTTCCAAGGAACGGTTGCACTCATGGCAGGTATTGATCTATCAAGCAACTATCTCTCCAATGAGATTCCTTCGGAGTTGTGCAATCTTGAAAGCATGAGGTTCCTAAACTTGTCGAGAAATCATCTATCTGGCATTATTCCTAAAGAGATTGGCAATTTGAAGATCCTCGAGTCTCTTGATTTTTCTTGGAATGAACTCTCCGGCTCTATTCCTTCAAGCATCTCAAATTTGATGTCTCTTAGTTCACTAAATTTGTCCAACAATCATTTATCAGGTGAGATACCATCTGGTTATCAACTCCGGACGCTTGCAGATCCATCAATTTATAGCAACAACTTTGGGTTATGTGGCTTCCCATTGAACATTTCATGTTCAGATGGTTCAAATTCTACATCAGCATTGATAGGGGGAAGTACAGACAGCCAGGAACTTGAAATCCTAAGCTGGTTTTACTCCGTATTAGCTGGGCTGGTCTTCGGATTTTGGCTGTGGTTCGGGGTACTGCTTTTGTTTGAGCCTTGGAGATTTGCCTTTTTTGGCCAAGTTGATCATCTACAAAAGAAGATTATGCAAAAGATTTGTTGCATGTATGCAAAATCTGAATAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MALRSRTHASKSIIPLRISLLLLLLSTPPCSSSTIIQHGEAESLLRWKSTLSAAASASPLTTWSPATSSSACSSWRGVTCDAAGHVAELSLPGAGLHGELRALDLAAFPALAKLDLRRNNITAGVVAANVSTRASNLTYLDLSDNAFAGHILDVLPLSPATLQQLSYLNLSSNGLYGPILRSLSAMGKMTVFDVSRNRLNSDIPSELFTNWVELTQFRVQNNSITGSIPPTICNTTKLKYLRLAKNKLTGEIPAEIGRLASLQALELADNFLTGPIPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRFSGTIPSDFGSRQFVTIVLASNSFSGEFPLTFCQLDSLEILDLSNNHLHGEIPSCLWHLQDLVFMDLSYNSFSGEVPPMSAYPNSSLESVHLANNNLTGGYPMVLKGCKWLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRSNVFNGSIPKELSQLSHLQLLDLAMNNLVGSIPRSFGNFTSMIQPKTELNLPWKVQHHILDGRVDYTYTDRIGINWKRQNQTFQGTVALMAGIDLSSNYLSNEIPSELCNLESMRFLNLSRNHLSGIIPKEIGNLKILESLDFSWNELSGSIPSSISNLMSLSSLNLSNNHLSGEIPSGYQLRTLADPSIYSNNFGLCGFPLNISCSDGSNSTSALIGGSTDSQELEILSWFYSVLAGLVFGFWLWFGVLLLFEPWRFAFFGQVDHLQKKIMQKICCMYAKSE


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
12-705 PTHR24420,FAMILY NOT NAMED

SIIPLRISLLLLLLSTPPCSSSTIIQHGEAESLLRWKSTLSAAASASPLTTWSPATSSSACSSWRGVTCDAAGHVAELSLPGAGLHGELRALDLAAFPALAKLDLRRNNITAGVVAANVSTRASNLTYLDLSDNAFAGHILDVLPLSPATLQQLSYLNLSSNGLYGPILRSLSAMGKMTVFDVSRNRLNSDIPSELFTNWVELTQFRVQNNSITGSIPPTICNTTKLKYLRLAKNKLTGEIPAEIGRLASLQALELADNFLTGPIPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRFSGTIPSDFGSRQFVTIVLASNSFSGEFPLTFCQLDSLEILDLSNNHLHGEIPSCLWHLQDLVFMDLSYNSFSGEVPPMSAYPNSSLESVHLANNNLTGGYPMVLKGCKWLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRSNVFNGSIPKELSQLSHLQLLDLAMNNLVGSIPRSFGNFTSMIQPKTELNLPWKVQHHILDGRVDYTYTDRIGINWKRQNQTFQGTVALMAGIDLSSNYLSNEIPSELCNLESMRFLNLSRNHLSGIIPKEIGNLKILESLDFSWNELSGSIPSSISNLMSLSSLNLSNNHLSGEIPSGYQLRTLADPSIYSNNFGLCGFPLNISCSDGSNSTSALIGGS

HMMPfam: PF08263
IPR013210
40-81 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EAESLLRWKSTLSAAASASPLTTWSPATSSSACSSWRGVTCD

Gene3D: G3DSA:3.80.10.10
41-208 G3DSA:3.80.10.10

AESLLRWKSTLSAAASASPLTTWSPATSSSACSSWRGVTCDAAGHVAELSLPGAGLHGELRALDLAAFPALAKLDLRRNNITAGVVAANVSTRASNLTYLDLSDNAFAGHILDVLPLSPATLQQLSYLNLSSNGLYGPILRSLSAMGKMTVFDVSRNRLNSDIPSELF

superfamily: SSF52047
88-354 SSF52047,LRR

ELSLPGAGLHGELRALDLAAFPALAKLDLRRNNITAGVVAANVSTRASNLTYLDLSDNAFAGHILDVLPLSPATLQQLSYLNLSSNGLYGPILRSLSAMGKMTVFDVSRNRLNSDIPSELFTNWVELTQFRVQNNSITGSIPPTICNTTKLKYLRLAKNKLTGEIPAEIGRLASLQALELADNFLTGPIPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRFSGTIPSDFGS

HMMPfam: PF13504
135-147 LRR_7,Leucine rich repeat

SNLTYLDLSDNAF

ProfileScan: PS51450
IPR001611
136-158 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSDNAFAGHILDVLPLS

ProfileScan: PS51450
IPR001611
164-184 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLSYLNLSSNGLYGPILRSLS

Gene3D: G3DSA:3.80.10.10
213-407 G3DSA:3.80.10.10

ELTQFRVQNNSITGSIPPTICNTTKLKYLRLAKNKLTGEIPAEIGRLASLQALELADNFLTGPIPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRFSGTIPSDFGSRQFVTIVLASNSFSGEFPLTFCQLDSLEILDLSNNHLHGEIPSCLWHLQDLVF

ProfileScan: PS51450
IPR001611
237-259 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLRLAKNKLTGEIPAEIGRL

ProfileScan: PS51450
IPR001611
261-283 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQALELADNFLTGPIPNSVGNL

superfamily: SSF52058
276-679 SSF52058,LRR

IPNSVGNLTDLLVMDLFSNGFTGVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRFSGTIPSDFGSRQFVTIVLASNSFSGEFPLTFCQLDSLEILDLSNNHLHGEIPSCLWHLQDLVFMDLSYNSFSGEVPPMSAYPNSSLESVHLANNNLTGGYPMVLKGCKWLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRSNVFNGSIPKELSQLSHLQLLDLAMNNLVGSIPRSFGNFTSMIQPKTELNLPWKVQHHILDGRVDYTYTDRIGINWKRQNQTFQGTVALMAGIDLSSNYLSNEIPSELCNLESMRFLNLSRNHLSGIIPKEIGNLKILESLDFSWNELSGSIPSSISNLMSLSSLNLSNNHLSGEIPSGYQLRTLADPSIYSNN

ProfileScan: PS51450
IPR001611
333-355 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLYGLDLSNNRFSGTIPSDFGSR

HMMPfam: PF00560
IPR001611
333-353 LRR_1
Leucine-rich repeat

NLYGLDLSNNRFSGTIPSDFG

FPrintScan: PR00019
334-347 LEURICHRPT,Leucine-rich repeat signature

LYGLDLSNNRFSGT

FPrintScan: PR00019
378-391 LEURICHRPT,Leucine-rich repeat signature

LDSLEILDLSNNHL

ProfileScan: PS51450
IPR001611
380-403 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILDLSNNHLHGEIPSCLWHLQ

HMMPfam: PF00560
IPR001611
380-402 LRR_1
Leucine-rich repeat

SLEILDLSNNHLHGEIPSCLWHL

Gene3D: G3DSA:3.80.10.10
408-527 G3DSA:3.80.10.10

MDLSYNSFSGEVPPMSAYPNSSLESVHLANNNLTGGYPMVLKGCKWLIILDLGGNHFTGTIPSWIGTCNPLLRFLILRSNVFNGSIPKELSQLSHLQLLDLAMNNLVGSIPRSFGNFTSM

HMMPfam: PF00560
IPR001611
454-473 LRR_1
Leucine-rich repeat

LIILDLGGNHFTGTIPSWIG

ProfileScan: PS51450
IPR001611
502-524 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQLLDLAMNNLVGSIPRSFGNF

HMMPfam: PF00560
IPR001611
502-523 LRR_1
Leucine-rich repeat

HLQLLDLAMNNLVGSIPRSFGN

Gene3D: G3DSA:3.80.10.10
576-665 G3DSA:3.80.10.10

AGIDLSSNYLSNEIPSELCNLESMRFLNLSRNHLSGIIPKEIGNLKILESLDFSWNELSGSIPSSISNLMSLSSLNLSNNHLSGEIPSGY

ProfileScan: PS51450
IPR001611
598-619 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SMRFLNLSRNHLSGIIPKEIGN

HMMPfam: PF00560
IPR001611
600-620 LRR_1
Leucine-rich repeat

RFLNLSRNHLSGIIPKEIGNL

ProfileScan: PS51450
IPR001611
622-644 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILESLDFSWNELSGSIPSSISNL

HMMPfam: PF12799
623-658 LRR_4,Leucine Rich repeats (2 copies)

LESLDFSWNELSGSIPSSISNLMSLSSLNLSNNHLS

ProfileScan: PS51450
IPR001611
646-668 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSSLNLSNNHLSGEIPSGYQLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox