PRGDB00048247 (P0404G11.142)

From PRG Wiki
Jump to: navigation, search
P0404G11.142
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50510216 (AP005448)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0404G11.

DNA Sequence

CTTACCAAGATGAAGGAGCTTCAGTATCTGGACCTAGCTTATAACAGCTTCTCAGGGGCAATACCATGGTCACTAGTGAATTTGACGGCAATGTCCCACAGGCCTGCTGACAATGATTCACTTTCATATATTGTCTATTACGGATGGTCACTCTCGACGTCAAATGTTAGAGTAATTATGTTGGCTAATCTTGGACCATACAATTTTGAAGAATCTGGACCTGACTTCAGCCACATTACTAGTGCCACTAATGAGAGTTTGTTGGTTGTCACCAAAGGGCAACAGCTTGAATTTAGAAGCGGAATCATTTATATGGTAAATATTGATCTGTCCTGCAACAATTTAACAGGCCATATTCCTGAGGATATTAGCATGCTCACTGCACTGAAAAACTTGAACCTATCTTGGAATCATCTAAGCGGGGTAATACCAACAAACATTGGAGCACTACAATCAATAGAATCTTTGGACCTGTCACACAATGAACTTTTTGGCCAAATTCCTACAAGTTTATCAGCCCCTGCGTCACTGAGCCACTTGAATTTGTCCTATAACAATTTGTCAGGACAAATACCTTATGGTAATCAGCTACGAACACTTGATGATCAGGCATCTATATATATCGGCAATCCGGGACTTTGTGGCCCACCACTCTCAAGGAATTGTTCGGAATCGTCGAAATTACTGCCAGACGCCGTTGATGAAGACAAAAGTTTGAGCGATGGGGTTTTCCTGTACCTTGGCATGGGCATAGGATGGGTAGTTGGTCTCTGGGTTGTCTTATGCACCTTCTTGTTCATGCAGAGATGGAGAATCATTTGTTTCTTGGTTTCTGACCGCTTGTACGACCGGATTCGGGCTTCCTTCACAAAACAATCTGGTAGAAACTGAATGACCAGGCCAAATCTTGTGTTTCCAGTCATAGCAACAACATGGTGCCTTCTGTTACTCCAAGCAGGCTCCTCCTCCCCTCCTCCTCAAACTGCACCTGCACCTGCACTTCCACCAAGCAATCCCTGCATCGCCCGCGAGCGGGACGCTCTGCTTGACCTCAAAGCAGGACTCCAAGATCCCAGCAACTACCTGGCATCCTGGCAAGGCGACAACTGCTGCGACGAATGGGAAGGCGTCGTATGCAGCAAGCGAAACGGCCATGTCGCGACGCTTACGCTCGAGTACGCTGGAATCGGAGGTAAGATAAGCCCATCCCTGCTTGCTCTACGGCATCTCAAGTCCATGAGCCTTGCTGGCAATGACTTCGGAGGTGAGCCGATCCCGGAGCTCTTCGGTGAACTCAAGAGCATGCGGCATCTCACCCTCGGTGATGCCAACTTCAGTGGGCTGGTTCCTCCTCATCTCGGCAACCTCTCCAGGTTGATCGATCTGGATCTCACAAGCTACAAGGGTCCAGGACTCTACTCGACGAATCTTGCGTGGTTGTCACGCTTGGCAAACCTACAGCATCTCTACTTGGGCGGCGTGAACCTCAGCACAGCATTCGACTGGGCTCACTCTCTCAACATGCTTCCATCTCTACAGCACTTGAGCCTTCGCAACTGTGGCCTACGCAACGCTATCCCTCCTCCGCTACACATGAACCTTACATCTCTGGAGGTAATTGACCTAAGTGGTAACCCCTTCCACTCACCTGTTGCAGTCGAAAAACTCTTTTGGCCATTTTGGGATTTTCCTAGACTTGAAACAATTTATCTAGAAAGTTGTGGGCTTCAGGGTATCCTCCCCGAGTATATGGGAAATTCCACATCCCTTGTAAATTTGGGCCTTAACTTCAACGATCTCACAGGGCTGCCAACCACATTCAAGAGACTAAGCAACTTGAAGTTTCTGTACCTTGCACAGAATAATATCAGTGGTGACATAGAAAAATTGTTAGATAAATTGCCTGATAATGGATTGTACGTACTAGAATTGTACGGGAACAATTTAGAGGGAAGCTTGCCAGCTCAAAAGGGACGATTGGGAAGTCTTTATAACCTTCGTATCAGTGATAACAAAATCTCAGGAGATATACCACTTTGGATTGGAGAACTCACAAACCTCACAAGTCTAGAGCTTGATTCCAACAACTTCCATGGCGTGATTACACAATTCCACTTGGCTAATCTAGCTAGTTTGAAAATTCTAGGGTTATCCCATAACACTCTAGCAATAGTGGCTGACCATAATTGGGTTCCTCCTTTCAAACTGATGATAGCCGGTTTAAAATCTTGTGGACTAGGGCCTAAATTCCCAGGATGGCTAAGGTCTCAAGATACGATTACTATGATGGATATTTCAAATACAAGCATAGCTGATTCTATACCTGATTGGTTCTGGACCACATTCTCCAACACTAGATATTTTGTTCTATCAGGAAATCAGATTAGTGGAGTGCTACCAGCAATGATGAACGAAAAAATGGTAGCCGAAGTAATGGATTTCAGTAACAACCTTCTGGAAGGTCAATTACAAAAGGTTCCAGAAAATTTAACATACCTTGACCTCTCAAAAAATAATCTATCAGGGCCACTACCACTTGATTTTGGAGCTCCATTTCTAGAGTCCCTTATTCTCTTCGAAAATTCATTGTCTGGTAAAATTCCACAATCTTTTTGTCAACTGAAGTATCTAGAATTTGTAGACCTATCTGCAAATCTACTACAAGGGCCATTTCCCAATTGTTTGAATATCTCACAAGCAGGCAACACGTCAAGGGCCGACCTGCTAGGTGTTCACCAAAACATCATTATGTTGAACTTAAATGACAATAATCTTTCTGGAATGTTCCCTTTATTTCTCCAAAAGTGCCAAAACCTAATATTTCTTGATCTCGCATTTAATCGATTTTCTGGGAGCTTACCAGCATGGATAGATGAGTTGTCAGCGTTAGCACTTTTTACG


Protein sequences

Name Description Sequence
putative Cf2/Cf5 disease resistance protein homolog putative Cf2/Cf5 disease resistance protein homolog [Oryza sativa Japonica Group].

MTRPNLVFPVIATTWCLLLLQAGSSSPPPQTAPAPALPPSNPCIARERDALLDLKAGLQDPSNYLASWQGDNCCDEWEGVVCSKRNGHVATLTLEYAGIGGKISPSLLALRHLKSMSLAGNDFGGEPIPELFGELKSMRHLTLGDANFSGLVPPHLGNLSRLIDLDLTSYKGPGLYSTNLAWLSRLANLQHLYLGGVNLSTAFDWAHSLNMLPSLQHLSLRNCGLRNAIPPPLHMNLTSLEVIDLSGNPFHSPVAVEKLFWPFWDFPRLETIYLESCGLQGILPEYMGNSTSLVNLGLNFNDLTGLPTTFKRLSNLKFLYLAQNNISGDIEKLLDKLPDNGLYVLELYGNNLEGSLPAQKGRLGSLYNLRISDNKISGDIPLWIGELTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLAIVADHNWVPPFKLMIAGLKSCGLGPKFPGWLRSQDTITMMDISNTSIADSIPDWFWTTFSNTRYFVLSGNQISGVLPAMMNEKMVAEVMDFSNNLLEGQLQKVPENLTYLDLSKNNLSGPLPLDFGAPFLESLILFENSLSGKIPQSFCQLKYLEFVDLSANLLQGPFPNCLNISQAGNTSRADLLGVHQNIIMLNLNDNNLSGMFPLFLQKCQNLIFLDLAFNRFSGSLPAWIDELSALALFTLTKMKELQYLDLAYNSFSGAIPWSLVNLTAMSHRPADNDSLSYIVYYGWSLSTSNVRVIMLANLGPYNFEESGPDFSHITSATNESLLVVTKGQQLEFRSGIIYMVNIDLSCNNLTGHIPEDISMLTALKNLNLSWNHLSGVIPTNIGALQSIESLDLSHNELFGQIPTSLSAPASLSHLNLSYNNLSGQIPYGNQLRTLDDQASIYIGNPGLCGPPLSRNCSESSKLLPDAVDEDKSLSDGVFLYLGMGIGWVVGLWVVLCTFLFMQRWRIICFLVSDRLYDRIRASFTKQSGRN


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
42-244 G3DSA:3.80.10.10

PCIARERDALLDLKAGLQDPSNYLASWQGDNCCDEWEGVVCSKRNGHVATLTLEYAGIGGKISPSLLALRHLKSMSLAGNDFGGEPIPELFGELKSMRHLTLGDANFSGLVPPHLGNLSRLIDLDLTSYKGPGLYSTNLAWLSRLANLQHLYLGGVNLSTAFDWAHSLNMLPSLQHLSLRNCGLRNAIPPPLHMNLTSLEVID

HMMPanther: PTHR24420
43-941 PTHR24420,FAMILY NOT NAMED

CIARERDALLDLKAGLQDPSNYLASWQGDNCCDEWEGVVCSKRNGHVATLTLEYAGIGGKISPSLLALRHLKSMSLAGNDFGGEPIPELFGELKSMRHLTLGDANFSGLVPPHLGNLSRLIDLDLTSYKGPGLYSTNLAWLSRLANLQHLYLGGVNLSTAFDWAHSLNMLPSLQHLSLRNCGLRNAIPPPLHMNLTSLEVIDLSGNPFHSPVAVEKLFWPFWDFPRLETIYLESCGLQGILPEYMGNSTSLVNLGLNFNDLTGLPTTFKRLSNLKFLYLAQNNISGDIEKLLDKLPDNGLYVLELYGNNLEGSLPAQKGRLGSLYNLRISDNKISGDIPLWIGELTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLAIVADHNWVPPFKLMIAGLKSCGLGPKFPGWLRSQDTITMMDISNTSIADSIPDWFWTTFSNTRYFVLSGNQISGVLPAMMNEKMVAEVMDFSNNLLEGQLQKVPENLTYLDLSKNNLSGPLPLDFGAPFLESLILFENSLSGKIPQSFCQLKYLEFVDLSANLLQGPFPNCLNISQAGNTSRADLLGVHQNIIMLNLNDNNLSGMFPLFLQKCQNLIFLDLAFNRFSGSLPAWIDELSALALFTLTKMKELQYLDLAYNSFSGAIPWSLVNLTAMSHRPADNDSLSYIVYYGWSLSTSNVRVIMLANLGPYNFEESGPDFSHITSATNESLLVVTKGQQLEFRSGIIYMVNIDLSCNNLTGHIPEDISMLTALKNLNLSWNHLSGVIPTNIGALQSIESLDLSHNELFGQIPTSLSAPASLSHLNLSYNNLSGQIPYGNQLRTLDDQASIYIGNPGLCGPPLSRNCSESSKLLPDAVDEDKSLSDGVFLYLGMGIGWVVGLWVVLCTFLFMQRWR

HMMPanther: PTHR24420:SF473
43-941 PTHR24420:SF473,SUBFAMILY NOT NAMED

CIARERDALLDLKAGLQDPSNYLASWQGDNCCDEWEGVVCSKRNGHVATLTLEYAGIGGKISPSLLALRHLKSMSLAGNDFGGEPIPELFGELKSMRHLTLGDANFSGLVPPHLGNLSRLIDLDLTSYKGPGLYSTNLAWLSRLANLQHLYLGGVNLSTAFDWAHSLNMLPSLQHLSLRNCGLRNAIPPPLHMNLTSLEVIDLSGNPFHSPVAVEKLFWPFWDFPRLETIYLESCGLQGILPEYMGNSTSLVNLGLNFNDLTGLPTTFKRLSNLKFLYLAQNNISGDIEKLLDKLPDNGLYVLELYGNNLEGSLPAQKGRLGSLYNLRISDNKISGDIPLWIGELTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLAIVADHNWVPPFKLMIAGLKSCGLGPKFPGWLRSQDTITMMDISNTSIADSIPDWFWTTFSNTRYFVLSGNQISGVLPAMMNEKMVAEVMDFSNNLLEGQLQKVPENLTYLDLSKNNLSGPLPLDFGAPFLESLILFENSLSGKIPQSFCQLKYLEFVDLSANLLQGPFPNCLNISQAGNTSRADLLGVHQNIIMLNLNDNNLSGMFPLFLQKCQNLIFLDLAFNRFSGSLPAWIDELSALALFTLTKMKELQYLDLAYNSFSGAIPWSLVNLTAMSHRPADNDSLSYIVYYGWSLSTSNVRVIMLANLGPYNFEESGPDFSHITSATNESLLVVTKGQQLEFRSGIIYMVNIDLSCNNLTGHIPEDISMLTALKNLNLSWNHLSGVIPTNIGALQSIESLDLSHNELFGQIPTSLSAPASLSHLNLSYNNLSGQIPYGNQLRTLDDQASIYIGNPGLCGPPLSRNCSESSKLLPDAVDEDKSLSDGVFLYLGMGIGWVVGLWVVLCTFLFMQRWR

HMMPfam: PF08263
IPR013210
46-83 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

RERDALLDLKAGLQDPSNYLASWQGDNCCDEWEGVVCS

superfamily: SSF52047
91-426 SSF52047,LRR

TLTLEYAGIGGKISPSLLALRHLKSMSLAGNDFGGEPIPELFGELKSMRHLTLGDANFSGLVPPHLGNLSRLIDLDLTSYKGPGLYSTNLAWLSRLANLQHLYLGGVNLSTAFDWAHSLNMLPSLQHLSLRNCGLRNAIPPPLHMNLTSLEVIDLSGNPFHSPVAVEKLFWPFWDFPRLETIYLESCGLQGILPEYMGNSTSLVNLGLNFNDLTGLPTTFKRLSNLKFLYLAQNNISGDIEKLLDKLPDNGLYVLELYGNNLEGSLPAQKGRLGSLYNLRISDNKISGDIPLWIGELTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLA

HMMPfam: PF12799
213-252 LRR_4,Leucine Rich repeats (2 copies)

PSLQHLSLRNCGLRNAIPPPLHMNLTSLEVIDLSGNPFHS

ProfileScan: PS51450
IPR001611
214-236 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQHLSLRNCGLRNAIPPPLHMN

ProfileScan: PS51450
IPR001611
239-260 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVIDLSGNPFHSPVAVEKLF

Gene3D: G3DSA:3.80.10.10
245-426 G3DSA:3.80.10.10

LSGNPFHSPVAVEKLFWPFWDFPRLETIYLESCGLQGILPEYMGNSTSLVNLGLNFNDLTGLPTTFKRLSNLKFLYLAQNNISGDIEKLLDKLPDNGLYVLELYGNNLEGSLPAQKGRLGSLYNLRISDNKISGDIPLWIGELTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLA

ProfileScan: PS51450
IPR001611
292-313 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVNLGLNFNDLTGLPTTFKRL

ProfileScan: PS51450
IPR001611
315-337 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKFLYLAQNNISGDIEKLLDKL

ProfileScan: PS51450
IPR001611
365-387 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLYNLRISDNKISGDIPLWIGEL

superfamily: SSF52058
387-498 SSF52058,LRR

LTNLTSLELDSNNFHGVITQFHLANLASLKILGLSHNTLAIVADHNWVPPFKLMIAGLKSCGLGPKFPGWLRSQDTITMMDISNTSIADSIPDWFWTTFSNTRYFVLSGNQI

ProfileScan: PS51450
IPR001611
389-410 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTSLELDSNNFHGVITQFHLA

ProfileScan: PS51450
IPR001611
414-435 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILGLSHNTLAIVADHNWVP

Gene3D: G3DSA:3.80.10.10
445-599 G3DSA:3.80.10.10

KSCGLGPKFPGWLRSQDTITMMDISNTSIADSIPDWFWTTFSNTRYFVLSGNQISGVLPAMMNEKMVAEVMDFSNNLLEGQLQKVPENLTYLDLSKNNLSGPLPLDFGAPFLESLILFENSLSGKIPQSFCQLKYLEFVDLSANLLQGPFPNCLN

superfamily: SSF52058
529-892 SSF52058,LRR

VPENLTYLDLSKNNLSGPLPLDFGAPFLESLILFENSLSGKIPQSFCQLKYLEFVDLSANLLQGPFPNCLNISQAGNTSRADLLGVHQNIIMLNLNDNNLSGMFPLFLQKCQNLIFLDLAFNRFSGSLPAWIDELSALALFTLTKMKELQYLDLAYNSFSGAIPWSLVNLTAMSHRPADNDSLSYIVYYGWSLSTSNVRVIMLANLGPYNFEESGPDFSHITSATNESLLVVTKGQQLEFRSGIIYMVNIDLSCNNLTGHIPEDISMLTALKNLNLSWNHLSGVIPTNIGALQSIESLDLSHNELFGQIPTSLSAPASLSHLNLSYNNLSGQIPYGNQLRTLDDQASIYIGNPGLCGPPLSRNC

ProfileScan: PS51450
IPR001611
532-553 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTYLDLSKNNLSGPLPLDFGA

HMMPfam: PF00560
IPR001611
532-552 LRR_1
Leucine-rich repeat

NLTYLDLSKNNLSGPLPLDFG

FPrintScan: PR00019
533-546 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSKNNLSGP

ProfileScan: PS51450
IPR001611
555-577 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLESLILFENSLSGKIPQSFCQL

Gene3D: G3DSA:3.80.10.10
616-703 G3DSA:3.80.10.10

QNIIMLNLNDNNLSGMFPLFLQKCQNLIFLDLAFNRFSGSLPAWIDELSALALFTLTKMKELQYLDLAYNSFSGAIPWSLVNLTAMSH

ProfileScan: PS51450
IPR001611
617-638 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIIMLNLNDNNLSGMFPLFLQK

ProfileScan: PS51450
IPR001611
641-663 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLIFLDLAFNRFSGSLPAWIDEL

ProfileScan: PS51450
IPR001611
676-699 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQYLDLAYNSFSGAIPWSLVNLT

HMMPfam: PF00560
IPR001611
677-698 LRR_1
Leucine-rich repeat

LQYLDLAYNSFSGAIPWSLVNL

ProfileScan: PS51450
IPR001611
774-796 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YMVNIDLSCNNLTGHIPEDISML

Gene3D: G3DSA:3.80.10.10
778-888 G3DSA:3.80.10.10

IDLSCNNLTGHIPEDISMLTALKNLNLSWNHLSGVIPTNIGALQSIESLDLSHNELFGQIPTSLSAPASLSHLNLSYNNLSGQIPYGNQLRTLDDQASIYIGNPGLCGPPL

HMMPfam: PF00560
IPR001611
778-794 LRR_1
Leucine-rich repeat

IDLSCNNLTGHIPEDIS

HMMPfam: PF13504
797-811 LRR_7,Leucine rich repeat

TALKNLNLSWNHLSG

ProfileScan: PS51450
IPR001611
798-820 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKNLNLSWNHLSGVIPTNIGAL

FPrintScan: PR00019
820-833 LEURICHRPT,Leucine-rich repeat signature

LQSIESLDLSHNEL

HMMPfam: PF13516
820-842 LRR_6,Leucine Rich repeat

LQSIESLDLSHNELFGQIPTSLS

ProfileScan: PS51450
IPR001611
822-844 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIESLDLSHNELFGQIPTSLSAP

ProfileScan: PS51450
IPR001611
846-868 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSHLNLSYNNLSGQIPYGNQLR

HMMPfam: PF00560
IPR001611
846-863 LRR_1
Leucine-rich repeat

SLSHLNLSYNNLSGQIPY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox