PRGDB00048254 (B1189A09.50)

From PRG Wiki
Jump to: navigation, search
B1189A09.50
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21327966 (AP003209)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1189A09.

DNA Sequence

ATGTCACCTCGGGTAGCCCAACGAGAGTACGAGCCGTTGTTACTTGTACTCCTCCTCCTACTACAAACCTTGATCGCGAGCTCGCTTCCATGCTTGCCGGACCAGGCGGCGGCGCTGCTCCAGCTGAAGCGATCGTTCTCGGCGACCACCGCGTCCGCCACCGCGTTCCGGTCATGGCGCGCCGGCACCGACTGCTGCCGCTGGGCGGGCGTCCGCTGCGACGGCGGCCGCGTCACTTTCCTCGATCTAGGCGGCCGACGCCTGCAGAGCGGCGGCCTTGACGCCGCCGTCTTCAGCCTCACGTCGCTGAGGTATCTCAACCTCGGCGGCAACGACTTCAACGCGTCACAGCTCCCGGCCACCGGATTCGAGAGGCTCACTGAGCTCACCCATCTCAACATCTCCCCACCCAGCTTCGCAGGCCAGATACCAGCAGGTATTGGAAGCCTCACCAACTTGGTTTCTCTTGATCTGTCATCTAGCATCTACATCGTCAATCAAGGAGATGACGATGTCAGTATCATGTCAAATTTGTTACCCCCCTGGGGCTTCTCGAGGGTAAACTTCGAGAAGTTGATTGCAAATCTTGGTAATCTGAGGGAGCTCTATCTTGGATTGGTGTACATGTCCAACGGAGGCGAAGGGTGGTGCAATGCTCTGGCTAATTCCACTCCTAAGATTCAGGTTCTGAGCCTACCATTATGCCAGATCTCTGGTCCCATTTGCCAATCTCTGTTTAGTTTGCGATCCCTTTCTGTTGTTGACTTGCAAGGAAATGACCTGTCTGGTGCCATACCTGAATTCTTCGCTGATTTGTCATCCCTTAGTGTTCTTCAGCTTTCAAGAAATAAGTTTGAGGGTTTGTTTCCACAAAGGATCTTCCAGAACAGAAAACTGACAGCTATTGATATTAGCTACAACTATGAAGTTTATGGTGATTTGCCCAATTTTCCACCTAATAGCAGTTTGATCAAATTGCATGTCAGTGGCACCAAGTTCTCAGGTTACATACCAAGCTCTATTTCTAATCTCACGGATCTGAAGGAGCTGAGTCTGAGTGCAAATAATTTCCCTACAGAACTGCCGTCTTCTCTAGGAATGCTTAAATCCTTGAACTTATTTGAGGTTTCGGGGCTCGGCCTAGTAGGATCAATGCCAGCTTGGATAACAAATCTAACATCTTTGACAGATCTCCAAATTTCTCATTGTGGTTTGTCTGGATCTTTACCATCTTCCATAGGCAATCTCAAGAATCTCAGAAGAATGTCTTTATTCAAGAGCAACTTCACTGGAAACATACCATTGCAAATCTTTAACTTGACACAACTGCATAGCTTGCATCTTCCACTAAACAACTTCGTGGGGACAGTGGAACTTACCTCATTCTGGAGACTACCATACTTATCACACCTTGATCTTTCAAATAATAAATTATCTGTGGTGGACGGGTTAGTCAATGATTCAGCAGTGTCCTCTCCCAAAGTAAAATTCTTGAGCCTAGCTTCCTGCAACATATCAAAGTTTCCCAATGCATTAAGACATCAAGATAAGATAATCTTCCTTGACCTTTCAAATAACCAAATGAATGGGGCAATACCTCCATGGGCATGGGAAACTTGGAAAGAATCGTTCTTCTTGGACCTATCAAATAACAAATTTACCAGTCTTGGACATGACACGTTGCTCCCCCTGTACACAAGATATATCAATCTCAGTTATAATATGTTTGAAGGACCCATACCTATACCTAAAGAGAGTACAGACTCTCAGTTGGATTACTCGAATAATCGGTTTTCTTCTATGCCGTTTGATCTAATTCCATATCTTGCTGGTACACTATCTCTAAAGGTCTCTATGAACAATGTCTCTGGAGAAGTCCCATCAACATTTTGTACTGTTAAGAGTCTCCAAATCCTTGACCTTTCCTACAATATCTTAAATGGCTCAATTCCTTCCTGTCTGATGGAGAATTCATCAACACTAAAAATATTAAATTTGAGGGGAAATGAACTTCGCGGAGAGTTGCCACATAATATGAAGGAAGACTGTGCATTTGAGGCATTGGATGTCAGCTATAATTGGATTGAAGGGACACTACCTAAATCATTAGTAACTTGCAAAAACTTGGTGGTACTTAATGTTGCGAACAATCAAATTGGAGGCTCTTTTCCATGTTGGATGCATCTTCTTCCTAAACTCCAAGTCCTTGTCCTGAAGTCCAATAAGTTCTACGGGCCGTTGGGGCCTACTCTTGCTAAAGATGATGAATGTGAACTACAGTATCTCCGAATTCTTGATCTAGCTTCAAACAACTTCTCGGGAGTATTGCCTTATGAATGGTTTAGGAAACTAAAATCCATGATGTCAGTCTCCATTAACGAAACATTGGTCATGAAAGATGGAGATATGTACAGCACATTTAACCATATAACATATCTTTTTACTGCTAGATTTACATATAAAGGACTGGACATGATGTTTCCTAAGATCTTAAAGACCTTTGTACTAATTGATGTCTCAAATAATAGATTCCATGGCAGCATTCCTGAAACTATTGCCACACTAAGCATGCTCAATGGTCTCAACATGTCACATAATGCTCTTACAGGACCAATTCCCAACCAGCTTGCTAGTCTGCATCAACTTGAGTCTTTGGACCTCTCATCAAATAAGCTTTCTGGGGAGATCCCTCAAAAATTAGCATCCTTGGACTTCCTATCAACATTGAACCTATCCGATAATATGCTGGAGGGAAGAATACCGGAGTCACCTCATTTCTTGACACTCCCCAATAGTTCATTTATACGAAATGCTGGTTTGTGTGGGCCTCCATTGTCGAAAGAATGCAGCAACAAATCAACATCAAATGTGATGCCACACCTTTCCGAAGAGAAATCTGCAGACATTATACTATTTCTCTTTGTTGGATTGGGTTTTGGTGTTGGGTTTGCTATTGCAATTGTAGTGAGGAAACCTTGCATTGGCAAATAA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MSPRVAQREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFVGLGFGVGFAIAIVVRKPCIGK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF500
7-991 PTHR26393:SF500

QREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFVGLGFGVGFAIAIVVRK

HMMPanther: PTHR26393
7-991 PTHR26393,FAMILY NOT NAMED

QREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFVGLGFGVGFAIAIVVRK

superfamily: SSF52058
24-291 SSF52058,LRR

LIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQ

Gene3D: G3DSA:3.80.10.10
30-159 G3DSA:3.80.10.10

PCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLS

HMMPfam: PF08263
IPR013210
33-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCD

ProfileScan: PS51450
IPR001611
102-125 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLNLGGNDFNASQLPATGFER

superfamily: SSF52058
208-578 SSF52058,LRR

YMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEG

Gene3D: G3DSA:3.80.10.10
210-307 G3DSA:3.80.10.10

SNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYN

HMMPfam: PF13855
250-307 LRR_8,Leucine rich repeat

SLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYN

ProfileScan: PS51450
IPR001611
274-295 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLQLSRNKFEGLFPQRIFQ

Gene3D: G3DSA:3.80.10.10
315-471 G3DSA:3.80.10.10

PNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHL

ProfileScan: PS51450
IPR001611
346-368 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLKELSLSANNFPTELPSSLGML

HMMPfam: PF13516
392-415 LRR_6,Leucine Rich repeat

LTSLTDLQISHCGLSGSLPSSIGN

HMMPfam: PF13516
465-479 LRR_6,Leucine Rich repeat

LPYLSHLDLSNNKLS

ProfileScan: PS51450
IPR001611
467-488 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLSHLDLSNNKLSVVDGLVNDS

FPrintScan: PR00019
468-481 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNKLSVV

Gene3D: G3DSA:3.80.10.10
472-667 G3DSA:3.80.10.10

DLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLR

ProfileScan: PS51450
IPR001611
494-515 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVKFLSLASCNISKFPNALRHQ

ProfileScan: PS51450
IPR001611
542-563 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ESFFLDLSNNKFTSLGHDTLLP

superfamily: SSF52058
585-949 SSF52058,LRR

ESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKEC

ProfileScan: PS51450
IPR001611
635-657 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQILDLSYNILNGSIPSCLMEN

ProfileScan: PS51450
IPR001611
660-682 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLKILNLRGNELRGELPHNMKED

HMMPfam: PF00560
IPR001611
661-678 LRR_1
Leucine-rich repeat

LKILNLRGNELRGELPHN

Gene3D: G3DSA:3.80.10.10
668-946 G3DSA:3.80.10.10

GNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLS

HMMPfam: PF13516
706-722 LRR_6,Leucine Rich repeat

CKNLVVLNVANNQIGGS

ProfileScan: PS51450
IPR001611
708-730 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVVLNVANNQIGGSFPCWMHLL

ProfileScan: PS51450
IPR001611
761-782 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRILDLASNNFSGVLPYEWFR

HMMPfam: PF00560
IPR001611
762-784 LRR_1
Leucine-rich repeat

LRILDLASNNFSGVLPYEWFRKL

ProfileScan: PS51450
IPR001611
857-880 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLNGLNMSHNALTGPIPNQLASLH

FPrintScan: PR00019
879-892 LEURICHRPT,Leucine-rich repeat signature

LHQLESLDLSSNKL

HMMPfam: PF13516
880-901 LRR_6,Leucine Rich repeat

HQLESLDLSSNKLSGEIPQKLA

ProfileScan: PS51450
IPR001611
881-904 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLESLDLSSNKLSGEIPQKLASLD

ProfileScan: PS51450
IPR001611
905-927 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSTLNLSDNMLEGRIPESPHFL


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox