PRGDB00048254 (B1189A09.50)

From PRG Wiki
Jump to: navigation, search
B1189A09.50
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21327966 (AP003209)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1189A09.

DNA Sequence

ATGTCACCTCGGGTAGCCCAACGAGAGTACGAGCCGTTGTTACTTGTACTCCTCCTCCTACTACAAACCTTGATCGCGAGCTCGCTTCCATGCTTGCCGGACCAGGCGGCGGCGCTGCTCCAGCTGAAGCGATCGTTCTCGGCGACCACCGCGTCCGCCACCGCGTTCCGGTCATGGCGCGCCGGCACCGACTGCTGCCGCTGGGCGGGCGTCCGCTGCGACGGCGGCCGCGTCACTTTCCTCGATCTAGGCGGCCGACGCCTGCAGAGCGGCGGCCTTGACGCCGCCGTCTTCAGCCTCACGTCGCTGAGGTATCTCAACCTCGGCGGCAACGACTTCAACGCGTCACAGCTCCCGGCCACCGGATTCGAGAGGCTCACTGAGCTCACCCATCTCAACATCTCCCCACCCAGCTTCGCAGGCCAGATACCAGCAGGTATTGGAAGCCTCACCAACTTGGTTTCTCTTGATCTGTCATCTAGCATCTACATCGTCAATCAAGGAGATGACGATGTCAGTATCATGTCAAATTTGTTACCCCCCTGGGGCTTCTCGAGGGTAAACTTCGAGAAGTTGATTGCAAATCTTGGTAATCTGAGGGAGCTCTATCTTGGATTGGTGTACATGTCCAACGGAGGCGAAGGGTGGTGCAATGCTCTGGCTAATTCCACTCCTAAGATTCAGGTTCTGAGCCTACCATTATGCCAGATCTCTGGTCCCATTTGCCAATCTCTGTTTAGTTTGCGATCCCTTTCTGTTGTTGACTTGCAAGGAAATGACCTGTCTGGTGCCATACCTGAATTCTTCGCTGATTTGTCATCCCTTAGTGTTCTTCAGCTTTCAAGAAATAAGTTTGAGGGTTTGTTTCCACAAAGGATCTTCCAGAACAGAAAACTGACAGCTATTGATATTAGCTACAACTATGAAGTTTATGGTGATTTGCCCAATTTTCCACCTAATAGCAGTTTGATCAAATTGCATGTCAGTGGCACCAAGTTCTCAGGTTACATACCAAGCTCTATTTCTAATCTCACGGATCTGAAGGAGCTGAGTCTGAGTGCAAATAATTTCCCTACAGAACTGCCGTCTTCTCTAGGAATGCTTAAATCCTTGAACTTATTTGAGGTTTCGGGGCTCGGCCTAGTAGGATCAATGCCAGCTTGGATAACAAATCTAACATCTTTGACAGATCTCCAAATTTCTCATTGTGGTTTGTCTGGATCTTTACCATCTTCCATAGGCAATCTCAAGAATCTCAGAAGAATGTCTTTATTCAAGAGCAACTTCACTGGAAACATACCATTGCAAATCTTTAACTTGACACAACTGCATAGCTTGCATCTTCCACTAAACAACTTCGTGGGGACAGTGGAACTTACCTCATTCTGGAGACTACCATACTTATCACACCTTGATCTTTCAAATAATAAATTATCTGTGGTGGACGGGTTAGTCAATGATTCAGCAGTGTCCTCTCCCAAAGTAAAATTCTTGAGCCTAGCTTCCTGCAACATATCAAAGTTTCCCAATGCATTAAGACATCAAGATAAGATAATCTTCCTTGACCTTTCAAATAACCAAATGAATGGGGCAATACCTCCATGGGCATGGGAAACTTGGAAAGAATCGTTCTTCTTGGACCTATCAAATAACAAATTTACCAGTCTTGGACATGACACGTTGCTCCCCCTGTACACAAGATATATCAATCTCAGTTATAATATGTTTGAAGGACCCATACCTATACCTAAAGAGAGTACAGACTCTCAGTTGGATTACTCGAATAATCGGTTTTCTTCTATGCCGTTTGATCTAATTCCATATCTTGCTGGTACACTATCTCTAAAGGTCTCTATGAACAATGTCTCTGGAGAAGTCCCATCAACATTTTGTACTGTTAAGAGTCTCCAAATCCTTGACCTTTCCTACAATATCTTAAATGGCTCAATTCCTTCCTGTCTGATGGAGAATTCATCAACACTAAAAATATTAAATTTGAGGGGAAATGAACTTCGCGGAGAGTTGCCACATAATATGAAGGAAGACTGTGCATTTGAGGCATTGGATGTCAGCTATAATTGGATTGAAGGGACACTACCTAAATCATTAGTAACTTGCAAAAACTTGGTGGTACTTAATGTTGCGAACAATCAAATTGGAGGCTCTTTTCCATGTTGGATGCATCTTCTTCCTAAACTCCAAGTCCTTGTCCTGAAGTCCAATAAGTTCTACGGGCCGTTGGGGCCTACTCTTGCTAAAGATGATGAATGTGAACTACAGTATCTCCGAATTCTTGATCTAGCTTCAAACAACTTCTCGGGAGTATTGCCTTATGAATGGTTTAGGAAACTAAAATCCATGATGTCAGTCTCCATTAACGAAACATTGGTCATGAAAGATGGAGATATGTACAGCACATTTAACCATATAACATATCTTTTTACTGCTAGATTTACATATAAAGGACTGGACATGATGTTTCCTAAGATCTTAAAGACCTTTGTACTAATTGATGTCTCAAATAATAGATTCCATGGCAGCATTCCTGAAACTATTGCCACACTAAGCATGCTCAATGGTCTCAACATGTCACATAATGCTCTTACAGGACCAATTCCCAACCAGCTTGCTAGTCTGCATCAACTTGAGTCTTTGGACCTCTCATCAAATAAGCTTTCTGGGGAGATCCCTCAAAAATTAGCATCCTTGGACTTCCTATCAACATTGAACCTATCCGATAATATGCTGGAGGGAAGAATACCGGAGTCACCTCATTTCTTGACACTCCCCAATAGTTCATTTATACGAAATGCTGGTTTGTGTGGGCCTCCATTGTCGAAAGAATGCAGCAACAAATCAACATCAAATGTGATGCCACACCTTTCCGAAGAGAAATCTGCAGACATTATACTATTTCTCTTTGTTGGATTGGGTTTTGGTGTTGGGTTTGCTATTGCAATTGTAGTGAGGAAACCTTGCATTGGCAAATAA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MSPRVAQREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFVGLGFGVGFAIAIVVRKPCIGK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF500
7-991 PTHR26393:SF500

QREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFVGLGFGVGFAIAIVVRK

HMMPanther: PTHR26393
7-991 PTHR26393,FAMILY NOT NAMED

QREYEPLLLVLLLLLQTLIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKECSNKSTSNVMPHLSEEKSADIILFLFVGLGFGVGFAIAIVVRK

superfamily: SSF52058
24-291 SSF52058,LRR

LIASSLPCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLSSSIYIVNQGDDDVSIMSNLLPPWGFSRVNFEKLIANLGNLRELYLGLVYMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQ

Gene3D: G3DSA:3.80.10.10
30-159 G3DSA:3.80.10.10

PCLPDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCDGGRVTFLDLGGRRLQSGGLDAAVFSLTSLRYLNLGGNDFNASQLPATGFERLTELTHLNISPPSFAGQIPAGIGSLTNLVSLDLS

HMMPfam: PF08263
IPR013210
33-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLQLKRSFSATTASATAFRSWRAGTDCCRWAGVRCD

ProfileScan: PS51450
IPR001611
102-125 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLNLGGNDFNASQLPATGFER

superfamily: SSF52058
208-578 SSF52058,LRR

YMSNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYNYEVYGDLPNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHLDLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEG

Gene3D: G3DSA:3.80.10.10
210-307 G3DSA:3.80.10.10

SNGGEGWCNALANSTPKIQVLSLPLCQISGPICQSLFSLRSLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYN

HMMPfam: PF13855
250-307 LRR_8,Leucine rich repeat

SLSVVDLQGNDLSGAIPEFFADLSSLSVLQLSRNKFEGLFPQRIFQNRKLTAIDISYN

ProfileScan: PS51450
IPR001611
274-295 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLQLSRNKFEGLFPQRIFQ

Gene3D: G3DSA:3.80.10.10
315-471 G3DSA:3.80.10.10

PNFPPNSSLIKLHVSGTKFSGYIPSSISNLTDLKELSLSANNFPTELPSSLGMLKSLNLFEVSGLGLVGSMPAWITNLTSLTDLQISHCGLSGSLPSSIGNLKNLRRMSLFKSNFTGNIPLQIFNLTQLHSLHLPLNNFVGTVELTSFWRLPYLSHL

ProfileScan: PS51450
IPR001611
346-368 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLKELSLSANNFPTELPSSLGML

HMMPfam: PF13516
392-415 LRR_6,Leucine Rich repeat

LTSLTDLQISHCGLSGSLPSSIGN

HMMPfam: PF13516
465-479 LRR_6,Leucine Rich repeat

LPYLSHLDLSNNKLS

ProfileScan: PS51450
IPR001611
467-488 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLSHLDLSNNKLSVVDGLVNDS

FPrintScan: PR00019
468-481 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSNNKLSVV

Gene3D: G3DSA:3.80.10.10
472-667 G3DSA:3.80.10.10

DLSNNKLSVVDGLVNDSAVSSPKVKFLSLASCNISKFPNALRHQDKIIFLDLSNNQMNGAIPPWAWETWKESFFLDLSNNKFTSLGHDTLLPLYTRYINLSYNMFEGPIPIPKESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLR

ProfileScan: PS51450
IPR001611
494-515 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVKFLSLASCNISKFPNALRHQ

ProfileScan: PS51450
IPR001611
542-563 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ESFFLDLSNNKFTSLGHDTLLP

superfamily: SSF52058
585-949 SSF52058,LRR

ESTDSQLDYSNNRFSSMPFDLIPYLAGTLSLKVSMNNVSGEVPSTFCTVKSLQILDLSYNILNGSIPSCLMENSSTLKILNLRGNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLSKEC

ProfileScan: PS51450
IPR001611
635-657 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQILDLSYNILNGSIPSCLMEN

ProfileScan: PS51450
IPR001611
660-682 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLKILNLRGNELRGELPHNMKED

HMMPfam: PF00560
IPR001611
661-678 LRR_1
Leucine-rich repeat

LKILNLRGNELRGELPHN

Gene3D: G3DSA:3.80.10.10
668-946 G3DSA:3.80.10.10

GNELRGELPHNMKEDCAFEALDVSYNWIEGTLPKSLVTCKNLVVLNVANNQIGGSFPCWMHLLPKLQVLVLKSNKFYGPLGPTLAKDDECELQYLRILDLASNNFSGVLPYEWFRKLKSMMSVSINETLVMKDGDMYSTFNHITYLFTARFTYKGLDMMFPKILKTFVLIDVSNNRFHGSIPETIATLSMLNGLNMSHNALTGPIPNQLASLHQLESLDLSSNKLSGEIPQKLASLDFLSTLNLSDNMLEGRIPESPHFLTLPNSSFIRNAGLCGPPLS

HMMPfam: PF13516
706-722 LRR_6,Leucine Rich repeat

CKNLVVLNVANNQIGGS

ProfileScan: PS51450
IPR001611
708-730 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVVLNVANNQIGGSFPCWMHLL

ProfileScan: PS51450
IPR001611
761-782 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRILDLASNNFSGVLPYEWFR

HMMPfam: PF00560
IPR001611
762-784 LRR_1
Leucine-rich repeat

LRILDLASNNFSGVLPYEWFRKL

ProfileScan: PS51450
IPR001611
857-880 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLNGLNMSHNALTGPIPNQLASLH

FPrintScan: PR00019
879-892 LEURICHRPT,Leucine-rich repeat signature

LHQLESLDLSSNKL

HMMPfam: PF13516
880-901 LRR_6,Leucine Rich repeat

HQLESLDLSSNKLSGEIPQKLA

ProfileScan: PS51450
IPR001611
881-904 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLESLDLSSNKLSGEIPQKLASLD

ProfileScan: PS51450
IPR001611
905-927 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSTLNLSDNMLEGRIPESPHFL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox