PRGDB00048256 (OSJNBa0052O12.42-2)

From PRG Wiki
Jump to: navigation, search
OSJNBa0052O12.42-2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20161828 (AP004330)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0052O12.

DNA Sequence

GTGCAGAACTTCCAACAATCAAGTGATATCTCTGCAATTGCAGATAACAGAATGGCCAGTGCCTATACCTCAGAAGGCATGAGAGAATTTCTGCGGTTGACATCGTGGTGCGTGAACCCGACGAGCGAGCATCGCCCATCGATGAACTTGGTGGAGGCGGAGATAAACCGAATTCGCGAGCAAGAGATGAGGATGACCACAATCATGCCAGAAAGCACACCAACTGTGACTCTAGGTAGTCAGCTCTTCACAACATCAGGTTGAAATGAGGGAATCCATAAATTTTTCCATTCAAAGTGATGTATACAGTTTTGGTGTTTTCCTTGTGGAGTTGCTCAGTGGCAAGAGGGCTCTGTCTGATCAAAACATCATTCGATGGGCCTAAATCACCTGCATTCTCTGACACCTCCCACGGTCCATATGAACTTCAAAACGGCCAACGTCCTTGTGGATGAAGATCTCATACCCAAAGTTGCAGATGCCGGCATCCGTGCCCTGCTAGATCGATTAGGCGGTGTAGGCCCTTCATCGAGAACATCTTACGATCCTTTCCTTGATCCCAGGTAGCAGCCATGCTCCAGGTGTAAAGCTAGAATTCAAGCAGAGACTTTCCATTGCTCATGGAGCTGCTAAAGGTTAATTATCTATCGTCGATCCGTCATCGTAACCTTGTAAACCTTTTGGGGTACTGCCAGGAGAATGGAATGCAGATGCTTGTTTACGAGTATGTTCCCAATGGCAGCGTTTCTACGCATTTACATGAGCTGCAGGGAGCAAGATGTATGACTCTGGAGGAGCTAAGTTCAGCTACAAGGAACTTCAGCAATGTGAATCTTATTGGACATGGAATGTTTGGAGAGGTTTACAAGGGTTTACTCCAGGATGGCACAATTGTAGCCATTAAAAAGCGACATTCTCCTCCTAGCCATGAATTTATTCATGAGATGTCAGCAATTCTTGCAGCATCTCTAGCAGGTGCTGCAGGATTCTTGGCATTAGTAGGCGCCGCCATATTTCTTATAGTACTTTTCCTCCGGCACCGCAGAAGAGCTTCAGACTCTTCGGAAAGTAGTTCATCCAGTCCAGCTCAACCAG


Protein sequences

Name Description Sequence
putative disease resistance protein kinase putative disease resistance protein kinase [Oryza sativa Japonica Group].

MSAILAASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTPTVTLGSQLFTTSG

Domains

Domain Start-End Description Sequence

Seg: seg
2-28 seg

SAILAASLAGAAGFLALVGAAIFLIVL

HMMPanther: PTHR24420
7-351 FAMILY NOT NAMED,FAMILY NOT NAMED

ASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTP

HMMPanther: PTHR24420:SF451
7-351 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTP

Gene3D: G3DSA:3.30.200.20
23-128 no description

IFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLG

Seg: seg
37-46 seg

SDSSESSSSS

superfamily: SSF56112
IPR011009
42-352 Protein kinase-like (PK-like)
Protein kinase-like domain

SSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTPT

ProfileScan: PS50011
IPR000719
70-335 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRI

HMMSmart: SM00220
IPR002290
70-335 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRI

HMMSmart: SM00219
IPR020635
70-332 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEI

HMMPfam: PF07714
IPR001245
74-328 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLV

PatternScan: PS00107
IPR017441
76-99 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGMFGEVYKGLLQDGTIVAIKK

Gene3D: G3DSA:1.10.510.10
129-325 no description

YCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSM


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox