PRGDB00048256 (OSJNBa0052O12.42-2)

From PRG Wiki
Jump to: navigation, search
OSJNBa0052O12.42-2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20161828 (AP004330)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0052O12.

DNA Sequence

GTGCAGAACTTCCAACAATCAAGTGATATCTCTGCAATTGCAGATAACAGAATGGCCAGTGCCTATACCTCAGAAGGCATGAGAGAATTTCTGCGGTTGACATCGTGGTGCGTGAACCCGACGAGCGAGCATCGCCCATCGATGAACTTGGTGGAGGCGGAGATAAACCGAATTCGCGAGCAAGAGATGAGGATGACCACAATCATGCCAGAAAGCACACCAACTGTGACTCTAGGTAGTCAGCTCTTCACAACATCAGGTTGAAATGAGGGAATCCATAAATTTTTCCATTCAAAGTGATGTATACAGTTTTGGTGTTTTCCTTGTGGAGTTGCTCAGTGGCAAGAGGGCTCTGTCTGATCAAAACATCATTCGATGGGCCTAAATCACCTGCATTCTCTGACACCTCCCACGGTCCATATGAACTTCAAAACGGCCAACGTCCTTGTGGATGAAGATCTCATACCCAAAGTTGCAGATGCCGGCATCCGTGCCCTGCTAGATCGATTAGGCGGTGTAGGCCCTTCATCGAGAACATCTTACGATCCTTTCCTTGATCCCAGGTAGCAGCCATGCTCCAGGTGTAAAGCTAGAATTCAAGCAGAGACTTTCCATTGCTCATGGAGCTGCTAAAGGTTAATTATCTATCGTCGATCCGTCATCGTAACCTTGTAAACCTTTTGGGGTACTGCCAGGAGAATGGAATGCAGATGCTTGTTTACGAGTATGTTCCCAATGGCAGCGTTTCTACGCATTTACATGAGCTGCAGGGAGCAAGATGTATGACTCTGGAGGAGCTAAGTTCAGCTACAAGGAACTTCAGCAATGTGAATCTTATTGGACATGGAATGTTTGGAGAGGTTTACAAGGGTTTACTCCAGGATGGCACAATTGTAGCCATTAAAAAGCGACATTCTCCTCCTAGCCATGAATTTATTCATGAGATGTCAGCAATTCTTGCAGCATCTCTAGCAGGTGCTGCAGGATTCTTGGCATTAGTAGGCGCCGCCATATTTCTTATAGTACTTTTCCTCCGGCACCGCAGAAGAGCTTCAGACTCTTCGGAAAGTAGTTCATCCAGTCCAGCTCAACCAG


Protein sequences

Name Description Sequence
putative disease resistance protein kinase putative disease resistance protein kinase [Oryza sativa Japonica Group].

MSAILAASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTPTVTLGSQLFTTSG

Domains

Domain Start-End Description Sequence

Seg: seg
2-28 seg

SAILAASLAGAAGFLALVGAAIFLIVL

HMMPanther: PTHR24420
7-351 FAMILY NOT NAMED,FAMILY NOT NAMED

ASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTP

HMMPanther: PTHR24420:SF451
7-351 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ASLAGAAGFLALVGAAIFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTP

Gene3D: G3DSA:3.30.200.20
23-128 no description

IFLIVLFLRHRRRASDSSESSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLG

Seg: seg
37-46 seg

SDSSESSSSS

superfamily: SSF56112
IPR011009
42-352 Protein kinase-like (PK-like)
Protein kinase-like domain

SSSSSPAQPELQGARCMTLEELSSATRNFSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRIREQEMRMTTIMPESTPT

ProfileScan: PS50011
IPR000719
70-335 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRI

HMMSmart: SM00220
IPR002290
70-335 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEINRI

HMMSmart: SM00219
IPR020635
70-332 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNVNLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLVEAEI

HMMPfam: PF07714
IPR001245
74-328 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NLIGHGMFGEVYKGLLQDGTIVAIKKRHSPPSHEFIHEVNYLSSIRHRNLVNLLGYCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSMNLV

PatternScan: PS00107
IPR017441
76-99 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGMFGEVYKGLLQDGTIVAIKK

Gene3D: G3DSA:1.10.510.10
129-325 no description

YCQENGMQMLVYEYVPNGSVSTHLHGSSHAPGVKLEFKQRLSIAHGAAKGLNHLHSLTPPTVHMNFKTANVLVDEDLIPKVADAGIRALLDRLGGVGPSSRTSYDPFLDPRMRESINFSIQSDVYSFGVFLVELLSGKRALSDQNIIRWVQNFQQSSDISAIADNRMASAYTSEGMREFLRLTSWCVNPTSEHRPSM


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox