PRGDB00048258 (P0699D11.30)

From PRG Wiki
Jump to: navigation, search
P0699D11.30
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9558510 (AP002817)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0699D11.

DNA Sequence

ATGGCGGAGGGTGCTCTCGCCTCGACCATCGTGAGGCAGGTGCTGACCAAGTTCGGCTCCTCCGTCTGGGACGAGCTCGCGCTCCTCTGTACCTTCAGGGCGGACCTCGCGGCCATGGAGGCCCAGTTCGCCACCATCCGCGCCGTGCTCGCCGACGCCGCCGTCCGCGACTGGCTCCGCAGGCTCAGGGACGTCGCCCACGACATCGACGACTTCCTCGACGCCTGCCACACCGACCTCCGCCGCGGCGAGGGCGGGGGCGACTGCTCCGTGTGCGGCGGCCTCACGCCGCGCTCGTTCGCCATGGCGCACAGGCTGAGGTCCCTCAGGCGCGAGCTGGGCGCCGTCGCCGCATCCAAGGACAGGTTCTCCCTGAGCCCCGACGCCCGCCCGCCCGCGTCGCGGCAGCTCCCCTCCGTCCCACTCATGCGCGAGACCATCTCCATGGTCGACGAGGCCAAGACGGTGGGGAGGAGCGCGGACAAGGAGAGGCTCATGAGGATGGTCCTCGACGCGGCGGGCGACGACGACGACGACGACGACGACGGCGTCTCCGTCATCCCCATCGTCGGCATCGGCGGCCTCGGCAAGACGACGCTGGCGCAGCTGGCGTTCAACGACCGGAGGGCCAACGACGAGGTGTTCGACCCCCGGATCTGGGTCTCCATGTCCGCCGGCTTCAGCCTCGCCACGCTGGTCCAGGCCGTGCACCCCATCGTCGCCGCGCCCAGCGAGAGGTGCGACCTCGCCACCACAACCACCACCAACCTGGAGGCCATCGCGCGCTTCTTGTCCATGGCGTTCACGGGGAACAAGTACCTGCTGGTCCTCGACGACGTGTGGAGCGAGAGCCACGACGAGTGGGAGCGGCTGAGGCTGCTCCTCAGGGGCGGCAAGCGGGGCAGCAAGATCATCGTGACGACGCGGAGCCGGAGGATCGGCATGATGGTGGGCACCGTGCCGCCATTGATGCTCAAGAGCCTCTCTGATGAGGATTGCTGGGAGCTGTTCAAGAGGAAGGCCTTTGAGGAAGCAGATGAGGAATTGTACCCAAAATTGGTCAGGATAGGGAAGGAGATTGTCCCCAAATGCGGCGGCGTGCCGCTGGCGGCGAAGGCCCTTGGGAGCATGCTGAGGTTCAAGAGGAATGAGGAATCATGGATTGCTGTCAGGGACAGTGAGATTTGGCAGCTGGATAAGGAGGAGACCATCTTGCCATCTCTCAAACTCAGCTATGATCAAATGCCACCCGTTCTGAAGCAATGCTTCGCGTATTGCTCGGTGTTTCCTCGAAACCATGAGATTGACAAGGGTAAGCTTATTCAGCAATGGGTTGCTCTTGGCTTTGTTGAACCCTCAAAGTATGGTTGCCAGCCGGTTTCTGATAAAGCGGACGACTGTTTTGAGCACTTGTTGTGGATGTCATTCCTTCAAGAGGTAGACCAACATGATTTGTCAAAGAAAGGATTAGAGGTTGATGGAAGAGTTAAGTACAAAATTCACGACTTGGTGCATGACCTTGCTCAGTCTGTTGCCGGGGATGAAGTTCAGATCATAAGCGCTAAGCGAGTCAATGGGAGGACAGAAGCTTGCCGCTATGCATCATTGCATGATGATATGGGGTCGACCGATGTTCTTTGGAGCATGCTTCGCAAAGTCCGTGCGTTTCATTCCTGGGGCCGTAGTCTTGACATTAATTTATTTCTTCACTCCAGGTTCTTGAGAGTACTAGATTTGCGCGGCAGCCAAATTATGGAGCTCCCTCAATCGGTTGGTAAATTGAAGCATTTGAGATACTTGGACCTTTCTTCATCCCTTATCAGTACTCTGCCCAATTGCATCAGTAGTCTCCACAATTTGCAAACTCTTCATTTATACAATTGCATAAATCTCAATGTGCTGCCCATGTCAGTATGTGCCCTTGAGAACCTAGAAATCTTGAATCTTTCAGCTTGCAACTTCCATAGCTTGCCAGATTCTATAGGACATCTTCAAAACCTACAAGATCTTAACTTGTCCCTTTGCAGTTTCCTTGTGACATTACCTAGCTCTATTGGTACACTCCAAAGTTTGCATTTGCTGAACTTGAAAGGATGTGGCAACCTTGAAATTCTACCTGACACTATATGCAGCCTGCAAAATTTACATTTCTTGAACCTTTCACGATGTGGTGTTCTCCAAGCACTGCCCAAAAATATTGGTAACCTTTCAAATTTGTTGCACCTGAATTTATCACAATGCACTGATCTTGAATCAATCCCAACCTCAATAGGTCGCATTAAGAGCTTGCATATTCTGGATCTGTCTCACTGTAGTAGTCTGTCAGAGTTACCAGGATCCATTGGTGGTCTTCATGAACTTCAGATACTCATTTTATCACACCATGCAAGCAGTTTGGCATTGCCTGTATCAACTAGTCATCTCCCAAACTTGCAGACTTTAGATCTCTCATGGAATCTTAGTCTAGAGGAATTGCCTGAATCAATTGGCAATCTTCATAGTTTGAAGACCCTGATCTTGTTCCAGTGCTGGAGTCTACGTAAGCTGCCTGAGTCTATAACCAACCTCATGATGTTAGAGAGTTTGAACTTTGTTGGCTGTGAAAACCTAGCTAAGTTACCTGATGGCATGACAAGGATCACCAATCTGAAACATTTAAGAAATGACCAATGTCGATCTTTAAAACAACTACCTAATGGATTTGGGCGATGGACTAAACTTGAAACATTGTCCTTACTCATGATAGGTGACAAGCATAGCAGTATCACGGAGCTGAAAGATCTAAACAATCTAACTGGTGAGCTCAGGATTGAATGTTGGTCACACAAGATGGATCTGACAACTGCTGCCAAAAGAGCAAACTGGAGAAATAAGAAAAAACTAAGCAAGTTGACCTTGTTGTGGACCATTCCTTGTTCTGCGGATGATTTTGAAAATGTTGAAACATTTCTTGAAGTTCTTGTGCCACCCGAAAATCTTGAGGTCCTTGAAATAGATGGTTACATGGGCACTAGATTTCCCAGTTGGATGATGAAGAGCATGGAATCATGGCTCCCAAATCTTGTCTCATTAGATTTAAGCAACATTCCTAACTGTAGCTGCCTACCACCCCTCAGACACATCCCTTATCTCCAATCGCTTCATCTCCGATACATGGCCGGTGTCCATAGCATGAGCTCTGAAATTCTTGTGAAAAGACAGAAATGTGTGCTGTACCAGTCACTGAAGGAACTCCATTTTGAAGACATGCCTAACCTAGAGACCTGGCCAACTTCAGCAGCGACAGATGACAGAGCTACTCAGCCAGAAGGATCCATGTTTCCTGTTCTTAAAACTGTAACCGCAACAGGATGCCCAAAGCTCAGGCCGAAACCATGCCTTCCAGATGCTATAACAGATTTGTCAATCTCCGACAGCAGCGAGATATTGTCAGTCAGGAAGATGTTTGGATCATCATCTTCCACATCCGCATCACTTCTGAGGAGATTGTGGATCAGAAAGTCCGATGTATCATCCAGTGAGTGGAAATTGTTGCAGCACAGGCCAAAACTTGAGGAACTAACCATCGAATACTGCGAAATGCTACGTGTTCTTGCAGAACCCATCAGGTACCTTACCACTCTGCGAAAGCTGAAGATCAGCAATTGCACTGAATTGGACGCGCTTCCAGAATGGATTGGTGATCTTGTAGCACTTGAATCTCTTCAAATAAGTTGCTGCCCAAAGTTGGTCTCGATCCCAAAAGGTTTGCAACATTTGACTGCTCTGGAGGAGTTAACTGTCACTGCCTGTAGCTCTGAGTTGAACGAAAACTGCAGGAAAGATACAGGCAAGGATTGGTTCAAGATCTGTCATATCCCAAACATCGTAATCTCGTGA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein -like NBS-LRR disease resistance protein -like [Oryza sativa Japonica Group].

MAEGALASTIVRQVLTKFGSSVWDELALLCTFRADLAAMEAQFATIRAVLADAAVRDWLRRLRDVAHDIDDFLDACHTDLRRGEGGGDCSVCGGLTPRSFAMAHRLRSLRRELGAVAASKDRFSLSPDARPPASRQLPSVPLMRETISMVDEAKTVGRSADKERLMRMVLDAAGDDDDDDDDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSAGFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKRGSKIIVTTRSRRIGMMVGTVPPLMLKSLSDEDCWELFKRKAFEEADEELYPKLVRIGKEIVPKCGGVPLAAKALGSMLRFKRNEESWIAVRDSEIWQLDKEETILPSLKLSYDQMPPVLKQCFAYCSVFPRNHEIDKGKLIQQWVALGFVEPSKYGCQPVSDKADDCFEHLLWMSFLQEVDQHDLSKKGLEVDGRVKYKIHDLVHDLAQSVAGDEVQIISAKRVNGRTEACRYASLHDDMGSTDVLWSMLRKVRAFHSWGRSLDINLFLHSRFLRVLDLRGSQIMELPQSVGKLKHLRYLDLSSSLISTLPNCISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLSLCSFLVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCGVLQALPKNIGNLSNLLHLNLSQCTDLESIPTSIGRIKSLHILDLSHCSSLSELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWNLSLEELPESIGNLHSLKTLILFQCWSLRKLPESITNLMMLESLNFVGCENLAKLPDGMTRITNLKHLRNDQCRSLKQLPNGFGRWTKLETLSLLMIGDKHSSITELKDLNNLTGELRIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTIPCSADDFENVETFLEVLVPPENLEVLEIDGYMGTRFPSWMMKSMESWLPNLVSLDLSNIPNCSCLPPLRHIPYLQSLHLRYMAGVHSMSSEILVKRQKCVLYQSLKELHFEDMPNLETWPTSAATDDRATQPEGSMFPVLKTVTATGCPKLRPKPCLPDAITDLSISDSSEILSVRKMFGSSSSTSASLLRRLWIRKSDVSSSEWKLLQHRPKLEELTIEYCEMLRVLAEPIRYLTTLRKLKISNCTELDALPEWIGDLVALESLQISCCPKLVSIPKGLQHLTALEELTVTACSSELNENCRKDTGKDWFKICHIPNIVIS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-1291 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAEGALASTIVRQVLTKFGSSVWDELALLCTFRADLAAMEAQFATIRAVLADAAVRDWLRRLRDVAHDIDDFLDACHTDLRRGEGGGDCSVCGGLTPRSFAMAHRLRSLRRELGAVAASKDRFSLSPDARPPASRQLPSVPLMRETISMVDEAKTVGRSADKERLMRMVLDAAGDDDDDDDDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSAGFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKRGSKIIVTTRSRRIGMMVGTVPPLMLKSLSDEDCWELFKRKAFEEADEELYPKLVRIGKEIVPKCGGVPLAAKALGSMLRFKRNEESWIAVRDSEIWQLDKEETILPSLKLSYDQMPPVLKQCFAYCSVFPRNHEIDKGKLIQQWVALGFVEPSKYGCQPVSDKADDCFEHLLWMSFLQEVDQHDLSKKGLEVDGRVKYKIHDLVHDLAQSVAGDEVQIISAKRVNGRTEACRYASLHDDMGSTDVLWSMLRKVRAFHSWGRSLDINLFLHSRFLRVLDLRGSQIMELPQSVGKLKHLRYLDLSSSLISTLPNCISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLSLCSFLVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCGVLQALPKNIGNLSNLLHLNLSQCTDLESIPTSIGRIKSLHILDLSHCSSLSELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWNLSLEELPESIGNLHSLKTLILFQCWSLRKLPESITNLMMLESLNFVGCENLAKLPDGMTRITNLKHLRNDQCRSLKQLPNGFGRWTKLETLSLLMIGDKHSSITELKDLNNLTGELRIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTIPCSADDFENVETFLEVLVPPENLEVLEIDGYMGTRFPSWMMKSMESWLPNLVSLDLSNIPNCSCLPPLRHIPYLQSLHLRYMAGVHSMSSEILVKRQKCVLYQSLKELHFEDMPNLETWPTSAATDDRATQPEGSMFPVLKTVTATGCPKLRPKPCLPDAITDLSISDSSEILSVRKMFGSSSSTSASLLRRLWIRKSDVSSSEWKLLQHRPKLEELTIEYCEMLRVLAEPIRYLTTLRKLKISNCTELDALPEWIGDLVALESLQISCCPKLVSIPKGLQHLTALEELTVTACSSELNENCRKDTGKDWFKICHIPNIVI

HMMPanther: PTHR23155:SF123
1-1291 PTHR23155:SF123,NBS-LRR DISEASE RESISTANCE PROTEIN-LIKE (PUTATIVE UNCHARACTERIZED PROTEIN) (OS01

MAEGALASTIVRQVLTKFGSSVWDELALLCTFRADLAAMEAQFATIRAVLADAAVRDWLRRLRDVAHDIDDFLDACHTDLRRGEGGGDCSVCGGLTPRSFAMAHRLRSLRRELGAVAASKDRFSLSPDARPPASRQLPSVPLMRETISMVDEAKTVGRSADKERLMRMVLDAAGDDDDDDDDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSAGFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKRGSKIIVTTRSRRIGMMVGTVPPLMLKSLSDEDCWELFKRKAFEEADEELYPKLVRIGKEIVPKCGGVPLAAKALGSMLRFKRNEESWIAVRDSEIWQLDKEETILPSLKLSYDQMPPVLKQCFAYCSVFPRNHEIDKGKLIQQWVALGFVEPSKYGCQPVSDKADDCFEHLLWMSFLQEVDQHDLSKKGLEVDGRVKYKIHDLVHDLAQSVAGDEVQIISAKRVNGRTEACRYASLHDDMGSTDVLWSMLRKVRAFHSWGRSLDINLFLHSRFLRVLDLRGSQIMELPQSVGKLKHLRYLDLSSSLISTLPNCISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLSLCSFLVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCGVLQALPKNIGNLSNLLHLNLSQCTDLESIPTSIGRIKSLHILDLSHCSSLSELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWNLSLEELPESIGNLHSLKTLILFQCWSLRKLPESITNLMMLESLNFVGCENLAKLPDGMTRITNLKHLRNDQCRSLKQLPNGFGRWTKLETLSLLMIGDKHSSITELKDLNNLTGELRIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTIPCSADDFENVETFLEVLVPPENLEVLEIDGYMGTRFPSWMMKSMESWLPNLVSLDLSNIPNCSCLPPLRHIPYLQSLHLRYMAGVHSMSSEILVKRQKCVLYQSLKELHFEDMPNLETWPTSAATDDRATQPEGSMFPVLKTVTATGCPKLRPKPCLPDAITDLSISDSSEILSVRKMFGSSSSTSASLLRRLWIRKSDVSSSEWKLLQHRPKLEELTIEYCEMLRVLAEPIRYLTTLRKLKISNCTELDALPEWIGDLVALESLQISCCPKLVSIPKGLQHLTALEELTVTACSSELNENCRKDTGKDWFKICHIPNIVI

superfamily: SSF52540
137-401 SSF52540

LPSVPLMRETISMVDEAKTVGRSADKERLMRMVLDAAGDDDDDDDDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSAGFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKRGSKIIVTTRSRRIGMMVGTVPPLMLKSLSDEDCWELFKRKAFEEADEELYPKLVRIGKEIVPKCGGVPLAAKALGSMLRFKRNEESWIAVRDSEIWQLDKE

Gene3D: G3DSA:3.40.50.300
158-310 G3DSA:3.40.50.300

RSADKERLMRMVLDAAGDDDDDDDDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSAGFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKRGSKIIVTTRS

HMMPfam: PF00931
IPR002182
181-453 NB-ARC,NBS
NB-ARC

DDGVSVIPIVGIGGLGKTTLAQLAFNDRRANDEVFDPRIWVSMSAGFSLATLVQAVHPIVAAPSERCDLATTTTTNLEAIARFLSMAFTGNKYLLVLDDVWSESHDEWERLRLLLRGGKRGSKIIVTTRSRRIGMMVGTVPPLMLKSLSDEDCWELFKRKAFEEADEELYPKLVRIGKEIVPKCGGVPLAAKALGSMLRFKRNEESWIAVRDSEIWQLDKEETILPSLKLSYDQMPPVLKQCFAYCSVFPRNHEIDKGKLIQQWVALGFVEPS

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

VIPIVGIGGLGKTTLA

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

AFTGNKYLLVLDDVW

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

CGGVPLAAKALGSML

superfamily: SSF52058
520-819 SSF52058,LRR

SAKRVNGRTEACRYASLHDDMGSTDVLWSMLRKVRAFHSWGRSLDINLFLHSRFLRVLDLRGSQIMELPQSVGKLKHLRYLDLSSSLISTLPNCISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLSLCSFLVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCGVLQALPKNIGNLSNLLHLNLSQCTDLESIPTSIGRIKSLHILDLSHCSSLSELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWN

Gene3D: G3DSA:3.80.10.10
562-787 G3DSA:3.80.10.10

SLDINLFLHSRFLRVLDLRGSQIMELPQSVGKLKHLRYLDLSSSLISTLPNCISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLSLCSFLVTLPSSIGTLQSLHLLNLKGCGNLEILPDTICSLQNLHFLNLSRCGVLQALPKNIGNLSNLLHLNLSQCTDLESIPTSIGRIKSLHILDLSHCSSLSELPGSIGGLHEL

HMMPfam: PF13855
574-628 LRR_8,Leucine rich repeat

LRVLDLRGSQIMELPQSVGKLKHLRYLDLSSSLISTLPNCISSLHNLQTLHLYNC

HMMPfam: PF00560
IPR001611
643-664 LRR_1
Leucine-rich repeat

NLEILNLSACNFHSLPDSIGHL

FPrintScan: PR00364
IPR000767
758-774 DISEASERSIST
Disease resistance protein

GRIKSLHILDLSHCSSL

HMMPfam: PF13855
762-819 LRR_8,Leucine rich repeat

SLHILDLSHCSSLSELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWN

superfamily: SSF52047
776-1087 SSF52047,LRR

ELPGSIGGLHELQILILSHHASSLALPVSTSHLPNLQTLDLSWNLSLEELPESIGNLHSLKTLILFQCWSLRKLPESITNLMMLESLNFVGCENLAKLPDGMTRITNLKHLRNDQCRSLKQLPNGFGRWTKLETLSLLMIGDKHSSITELKDLNNLTGELRIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTIPCSADDFENVETFLEVLVPPENLEVLEIDGYMGTRFPSWMMKSMESWLPNLVSLDLSNIPNCSCLPPLRHIPYLQSLHLRYMAGVHSMSSEILVKRQKCVLYQSLKELHFEDMPNLE

Gene3D: G3DSA:3.80.10.10
788-994 G3DSA:3.80.10.10

QILILSHHASSLALPVSTSHLPNLQTLDLSWNLSLEELPESIGNLHSLKTLILFQCWSLRKLPESITNLMMLESLNFVGCENLAKLPDGMTRITNLKHLRNDQCRSLKQLPNGFGRWTKLETLSLLMIGDKHSSITELKDLNNLTGELRIECWSHKMDLTTAAKRANWRNKKKLSKLTLLWTIPCSADDFENVETFLEVLVPPENLE

Gene3D: G3DSA:3.80.10.10
995-1265 G3DSA:3.80.10.10

VLEIDGYMGTRFPSWMMKSMESWLPNLVSLDLSNIPNCSCLPPLRHIPYLQSLHLRYMAGVHSMSSEILVKRQKCVLYQSLKELHFEDMPNLETWPTSAATDDRATQPEGSMFPVLKTVTATGCPKLRPKPCLPDAITDLSISDSSEILSVRKMFGSSSSTSASLLRRLWIRKSDVSSSEWKLLQHRPKLEELTIEYCEMLRVLAEPIRYLTTLRKLKISNCTELDALPEWIGDLVALESLQISCCPKLVSIPKGLQHLTALEELTVTACS

superfamily: SSF52047
1129-1265 SSF52047,LRR

DAITDLSISDSSEILSVRKMFGSSSSTSASLLRRLWIRKSDVSSSEWKLLQHRPKLEELTIEYCEMLRVLAEPIRYLTTLRKLKISNCTELDALPEWIGDLVALESLQISCCPKLVSIPKGLQHLTALEELTVTACS


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox