PRGDB00048259 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGACCCGTTACAAGCTATTGTTCATGACATTGCTGCTCCTCCTCTTACACACCCAGCTCGTTGTCCCTTCTTCATCAGCAACATCAGCTACGTACACCAACCACACCGGAGTGCCGCCGTCGGCGGTTCCATGCATGCCGGACCAGGCATCGGCGTTGCTCCGACTGAAACGATCCTTCTCCATCACCAACAAGTCCGTGATCGCCCTCCGGTCATGGAACGCCGGCGAGGATTGCTGCCGGTGGGAAGGCGTCCGCTGCGGCGGCGGCGGCACCGCCGCCGCCGGCGGCCGCGTGACATGGCTTGATTTGGGTGACCGTGGCTTGAAGAGTGGCCACCTCGATCAGGTGATTTTCAAGCTGAATTCCCTGGAGTATCTCAACCTGGCCGGAAATGACTTCAACCTGTCCGAAATCCCATTCACTGGCTTCGAGCGGTTGAGTATGCTCACCCATCTGAACCTCTCCTCGTCCAACTTCGCAGGCCAAGTGCCTGTGCATAGCATTGGTCAGCTCACAAATTTGATCTCCCTTGACCTCTCCTTTCGTTTCAAAGTTACTGAACTATTCGATATGGGTTACTTATATACCGGTGCATACTCTCACGAATGGCAGCTCGTCCTGCCGAACTTGACAGCCTTGGTTGCAAATCTTAGCAATTTGGAGGAGCTTCGTCTTGGCTTTCTTGACCTATCACACCAAGAAGCTGACTGGTGCAATGCTTTAGGCATGTATACTCAAAATCTTCGTGTTCTCAGCCTGCCCTTTTGCTGGTTATCTAGCCCCATTTGCGGGTCGCTCTCCAACTTGCGCTCACTGTCAGTTATTGACATGCAGTTCAGTGGTTTGACGGGTCGGTTTCCAGATTTCTTTGCCAACTTATCCTCCTTGAGTGTTCTCCAGCTTAGCTTTAATCACCTTGAAGGATGGGTCCCTCCTTTAATCTTTCAGAAGAAGAAGCTAGTGGCTATTGATCTTCACAGAAATGTTGGATTATCTGGTACTCTGCCTGATTTTCCCGTGGATAGTAGTTTGGAGATTTTGCTTGTTGGTCACACCAACTTCTCTGGTACGATACCAAGTTTCATTAGCAACCTCAAATCTTTGAAGAAGCTAGGCCTTGATGCAAGTGGTTTTTCTGGAGAGTTACCCTCAATAATCGGTACGCTTAGACATTTGAATTCATTGCAGATCTCTGGGTTAGAGGTAGTAGAGTCGTTTCCCAAATGGATCACAAACTTAACTTCCTTGGAGGTCCTTGAGTTTTCCAATTGTGGCTTACACGGAACGATACCTTCTTCTATTGCAGACCTGACAAAATTGACAAAGTTAGCACTATATGCCTGCAATCTTTTTGGGGAAATACCTCGACATATATTCAATTTAACACAACTGGATACCATCTTTCTTCATTCAAATAGTTTTACTGGCACAGTCGAACTTGCCTCATTCTTGACACTACCAAACCTATTTGACTTAAACCTCTCACACAACAAATTAACTGTAATAAATGGAGAAAGCAATTCTTCACTCACATCCTTCCCCAACATAGGGTACTTGGGTTTGTCATCTTGTAACATGACTAGATTTCCGAACATTTTGAAACATCTAAACAAGAATGAAGTGAATGGCATTGATCTTTCACATAACCATATCCAAGGGGCCATACCCCATTGGGCATGGGAGAACTGGAAAGATGCTCAATTTTTCTTTTTGAACTTGTCACACAATGAATTCACTAGGGTTGGCCACACCATCTTTCCTTTTGGTGTAGAAATGTTGGATCTCAGTTTTAACAAGTTTGAGGGGCCAATACCACTTCCCCAAAACTCTGGAACGGTGCTTGATTACTCAAACAACCGTTTCTCGTCCATACCACCAAATATTTCTACTCAACTTAGAGATACTGCCTATTTCAAGGCATCAAGAAACAACATCTCCGGAGACATTCCAACATCCTTTTGTAGTAATAAACTACAGTTTCTTGATCTCTCTTTCAATTTTTTTAGTGGATCAATTCCTCCTTGCCTGATCGAGGTTGCCGGTGCATTACAAGTACTAAATCTGAAACAAAATCAACTTCATGGAGAACTACCACATTATTTCAACGAAAGTTGCACATTGGAGGCACTAGACTTTAGTGACAATAGGATTGAAGGAAATTTGCCTAGATCTATTGCTTCTTGCCGAAAATTGGAGGTCCTTGATATCCAAAACAATCATATCGCTGACTATTTTCCTTGTTGGATGAGTGCATTTCCTAGACTCCAAGTCCTTGTCTTGAAATCTAACAAGTTCTTTGGACAAGTGGCACCTTCTGTTGGCGAAGACAGCAGTTGTGAATTTCCTAGTTTATGTATCCTGGATCTAGCCTCCAACAAATTTTCAGGCACATTGAGTGAAGAATGGTTTACAAGATTGAAGTCCATGATGATTGACTCAGTTAATGGTACATCAGTGATGGAATATAAAGGTGATAAAAAACGAGTCTACCAAGTTACCACTGTGCTCACATACAAAGGATCTACCATGAGGATAGATAAAATACTAAGGACTTTTGTATTCATTGATGTCTCGAATAATGCATTCCATGGAAGCGTCCCTAAAGCTATTGGAGAGTTAGTTCTGCTAAACACGCTCAACATGTCACACAACTCATTAACAGGGCCGGTTCCAACTCAACTTAGCCATCTAAACCAGATGGAGGCTTTGGACCTGTCCTCAAACGAGCTTTCAGGAGTGATTCTACAGGAGCTAGCATCGTTGCATTTCCTCACAACACTGAACCTGTCCTACAACAGGCTGGTGGGAAGAATACCAGAGTCAACTCAATTCTCAACATTCCTGAACAACTCGTTTCTAGGGAATGATGGTTTGTGTGGCCCTCCATTGTCAAAAGGATGTGACAACATGACGCTGAATGTTACACTTTCTGACAGGAAATCTATAGACATTGTGTTGTTCCTCTTTTCTGGATTGGGATTTGGCCTTGGATTTGCAATTGCAATTGTAATAGCATGGGGAGTTCCCATTAGAAAATGGTCGCTACTAGGGCAGAGAGTCCCCTGA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MTRYKLLFMTLLLLLLHTQLVVPSSSATSATYTNHTGVPPSAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQRVP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF520
20-1020 PTHR26393:SF520

LVVPSSSATSATYTNHTGVPPSAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQR

HMMPanther: PTHR26393
20-1020 PTHR26393,FAMILY NOT NAMED

LVVPSSSATSATYTNHTGVPPSAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQR

superfamily: SSF52058
41-233 SSF52058,LRR

SAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSH

Gene3D: G3DSA:3.80.10.10
45-182 G3DSA:3.80.10.10

CMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSF

HMMPfam: PF08263
IPR013210
47-87 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRC

ProfileScan: PS51450
IPR001611
123-143 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLNLAGNDFNLSEIPFTG

HMMPfam: PF00560
IPR001611
123-147 LRR_1
Leucine-rich repeat

SLEYLNLAGNDFNLSEIPFTGFERL

superfamily: SSF52058
198-606 SSF52058,LRR

GAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIP

Gene3D: G3DSA:3.80.10.10
215-441 G3DSA:3.80.10.10

VANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKL

ProfileScan: PS51450
IPR001611
296-318 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLQLSFNHLEGWVPPLIFQK

HMMPfam: PF13516
414-436 LRR_6,Leucine Rich repeat

LTSLEVLEFSNCGLHGTIPSSIA

Gene3D: G3DSA:3.80.10.10
442-551 G3DSA:3.80.10.10

TKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNH

superfamily: SSF52047
454-847 SSF52047,LRR

EIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRID

ProfileScan: PS51450
IPR001611
489-510 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFDLNLSHNKLTVINGESNSS

ProfileScan: PS51450
IPR001611
516-537 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIGYLGLSSCNMTRFPNILKHL

Gene3D: G3DSA:3.80.10.10
552-691 G3DSA:3.80.10.10

IQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQ

ProfileScan: PS51450
IPR001611
611-632 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SGTVLDYSNNRFSSIPPNISTQ

ProfileScan: PS51450
IPR001611
658-680 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQFLDLSFNFFSGSIPPCLIEV

HMMPfam: PF00560
IPR001611
658-676 LRR_1
Leucine-rich repeat

KLQFLDLSFNFFSGSIPPC

ProfileScan: PS51450
IPR001611
683-705 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQVLNLKQNQLHGELPHYFNES

Gene3D: G3DSA:3.80.10.10
692-812 G3DSA:3.80.10.10

NQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMI

HMMPfam: PF12799
707-744 LRR_4,Leucine Rich repeats (2 copies)

TLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIAD

ProfileScan: PS51450
IPR001611
707-729 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEALDFSDNRIEGNLPRSIASC

ProfileScan: PS51450
IPR001611
731-744 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLDIQNNHIAD

ProfileScan: PS51450
IPR001611
784-806 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLCILDLASNKFSGTLSEEWFTR

superfamily: SSF52058
850-982 SSF52058,LRR

LRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKS

Gene3D: G3DSA:3.80.10.10
856-965 G3DSA:3.80.10.10

IDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLS

ProfileScan: PS51450
IPR001611
876-899 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLNTLNMSHNSLTGPVPTQLSHLN

ProfileScan: PS51450
IPR001611
900-923 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QMEALDLSSNELSGVILQELASLH

ProfileScan: PS51450
IPR001611
924-946 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLTTLNLSYNRLVGRIPESTQFS

HMMPfam: PF00560
IPR001611
925-942 LRR_1
Leucine-rich repeat

LTTLNLSYNRLVGRIPES


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox