PRGDB00048259 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGACCCGTTACAAGCTATTGTTCATGACATTGCTGCTCCTCCTCTTACACACCCAGCTCGTTGTCCCTTCTTCATCAGCAACATCAGCTACGTACACCAACCACACCGGAGTGCCGCCGTCGGCGGTTCCATGCATGCCGGACCAGGCATCGGCGTTGCTCCGACTGAAACGATCCTTCTCCATCACCAACAAGTCCGTGATCGCCCTCCGGTCATGGAACGCCGGCGAGGATTGCTGCCGGTGGGAAGGCGTCCGCTGCGGCGGCGGCGGCACCGCCGCCGCCGGCGGCCGCGTGACATGGCTTGATTTGGGTGACCGTGGCTTGAAGAGTGGCCACCTCGATCAGGTGATTTTCAAGCTGAATTCCCTGGAGTATCTCAACCTGGCCGGAAATGACTTCAACCTGTCCGAAATCCCATTCACTGGCTTCGAGCGGTTGAGTATGCTCACCCATCTGAACCTCTCCTCGTCCAACTTCGCAGGCCAAGTGCCTGTGCATAGCATTGGTCAGCTCACAAATTTGATCTCCCTTGACCTCTCCTTTCGTTTCAAAGTTACTGAACTATTCGATATGGGTTACTTATATACCGGTGCATACTCTCACGAATGGCAGCTCGTCCTGCCGAACTTGACAGCCTTGGTTGCAAATCTTAGCAATTTGGAGGAGCTTCGTCTTGGCTTTCTTGACCTATCACACCAAGAAGCTGACTGGTGCAATGCTTTAGGCATGTATACTCAAAATCTTCGTGTTCTCAGCCTGCCCTTTTGCTGGTTATCTAGCCCCATTTGCGGGTCGCTCTCCAACTTGCGCTCACTGTCAGTTATTGACATGCAGTTCAGTGGTTTGACGGGTCGGTTTCCAGATTTCTTTGCCAACTTATCCTCCTTGAGTGTTCTCCAGCTTAGCTTTAATCACCTTGAAGGATGGGTCCCTCCTTTAATCTTTCAGAAGAAGAAGCTAGTGGCTATTGATCTTCACAGAAATGTTGGATTATCTGGTACTCTGCCTGATTTTCCCGTGGATAGTAGTTTGGAGATTTTGCTTGTTGGTCACACCAACTTCTCTGGTACGATACCAAGTTTCATTAGCAACCTCAAATCTTTGAAGAAGCTAGGCCTTGATGCAAGTGGTTTTTCTGGAGAGTTACCCTCAATAATCGGTACGCTTAGACATTTGAATTCATTGCAGATCTCTGGGTTAGAGGTAGTAGAGTCGTTTCCCAAATGGATCACAAACTTAACTTCCTTGGAGGTCCTTGAGTTTTCCAATTGTGGCTTACACGGAACGATACCTTCTTCTATTGCAGACCTGACAAAATTGACAAAGTTAGCACTATATGCCTGCAATCTTTTTGGGGAAATACCTCGACATATATTCAATTTAACACAACTGGATACCATCTTTCTTCATTCAAATAGTTTTACTGGCACAGTCGAACTTGCCTCATTCTTGACACTACCAAACCTATTTGACTTAAACCTCTCACACAACAAATTAACTGTAATAAATGGAGAAAGCAATTCTTCACTCACATCCTTCCCCAACATAGGGTACTTGGGTTTGTCATCTTGTAACATGACTAGATTTCCGAACATTTTGAAACATCTAAACAAGAATGAAGTGAATGGCATTGATCTTTCACATAACCATATCCAAGGGGCCATACCCCATTGGGCATGGGAGAACTGGAAAGATGCTCAATTTTTCTTTTTGAACTTGTCACACAATGAATTCACTAGGGTTGGCCACACCATCTTTCCTTTTGGTGTAGAAATGTTGGATCTCAGTTTTAACAAGTTTGAGGGGCCAATACCACTTCCCCAAAACTCTGGAACGGTGCTTGATTACTCAAACAACCGTTTCTCGTCCATACCACCAAATATTTCTACTCAACTTAGAGATACTGCCTATTTCAAGGCATCAAGAAACAACATCTCCGGAGACATTCCAACATCCTTTTGTAGTAATAAACTACAGTTTCTTGATCTCTCTTTCAATTTTTTTAGTGGATCAATTCCTCCTTGCCTGATCGAGGTTGCCGGTGCATTACAAGTACTAAATCTGAAACAAAATCAACTTCATGGAGAACTACCACATTATTTCAACGAAAGTTGCACATTGGAGGCACTAGACTTTAGTGACAATAGGATTGAAGGAAATTTGCCTAGATCTATTGCTTCTTGCCGAAAATTGGAGGTCCTTGATATCCAAAACAATCATATCGCTGACTATTTTCCTTGTTGGATGAGTGCATTTCCTAGACTCCAAGTCCTTGTCTTGAAATCTAACAAGTTCTTTGGACAAGTGGCACCTTCTGTTGGCGAAGACAGCAGTTGTGAATTTCCTAGTTTATGTATCCTGGATCTAGCCTCCAACAAATTTTCAGGCACATTGAGTGAAGAATGGTTTACAAGATTGAAGTCCATGATGATTGACTCAGTTAATGGTACATCAGTGATGGAATATAAAGGTGATAAAAAACGAGTCTACCAAGTTACCACTGTGCTCACATACAAAGGATCTACCATGAGGATAGATAAAATACTAAGGACTTTTGTATTCATTGATGTCTCGAATAATGCATTCCATGGAAGCGTCCCTAAAGCTATTGGAGAGTTAGTTCTGCTAAACACGCTCAACATGTCACACAACTCATTAACAGGGCCGGTTCCAACTCAACTTAGCCATCTAAACCAGATGGAGGCTTTGGACCTGTCCTCAAACGAGCTTTCAGGAGTGATTCTACAGGAGCTAGCATCGTTGCATTTCCTCACAACACTGAACCTGTCCTACAACAGGCTGGTGGGAAGAATACCAGAGTCAACTCAATTCTCAACATTCCTGAACAACTCGTTTCTAGGGAATGATGGTTTGTGTGGCCCTCCATTGTCAAAAGGATGTGACAACATGACGCTGAATGTTACACTTTCTGACAGGAAATCTATAGACATTGTGTTGTTCCTCTTTTCTGGATTGGGATTTGGCCTTGGATTTGCAATTGCAATTGTAATAGCATGGGGAGTTCCCATTAGAAAATGGTCGCTACTAGGGCAGAGAGTCCCCTGA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MTRYKLLFMTLLLLLLHTQLVVPSSSATSATYTNHTGVPPSAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQRVP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF520
20-1020 PTHR26393:SF520

LVVPSSSATSATYTNHTGVPPSAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQR

HMMPanther: PTHR26393
20-1020 PTHR26393,FAMILY NOT NAMED

LVVPSSSATSATYTNHTGVPPSAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRIDKILRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKSIDIVLFLFSGLGFGLGFAIAIVIAWGVPIRKWSLLGQR

superfamily: SSF52058
41-233 SSF52058,LRR

SAVPCMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSFRFKVTELFDMGYLYTGAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSH

Gene3D: G3DSA:3.80.10.10
45-182 G3DSA:3.80.10.10

CMPDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRCGGGGTAAAGGRVTWLDLGDRGLKSGHLDQVIFKLNSLEYLNLAGNDFNLSEIPFTGFERLSMLTHLNLSSSNFAGQVPVHSIGQLTNLISLDLSF

HMMPfam: PF08263
IPR013210
47-87 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQASALLRLKRSFSITNKSVIALRSWNAGEDCCRWEGVRC

ProfileScan: PS51450
IPR001611
123-143 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLNLAGNDFNLSEIPFTG

HMMPfam: PF00560
IPR001611
123-147 LRR_1
Leucine-rich repeat

SLEYLNLAGNDFNLSEIPFTGFERL

superfamily: SSF52058
198-606 SSF52058,LRR

GAYSHEWQLVLPNLTALVANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKLTKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIP

Gene3D: G3DSA:3.80.10.10
215-441 G3DSA:3.80.10.10

VANLSNLEELRLGFLDLSHQEADWCNALGMYTQNLRVLSLPFCWLSSPICGSLSNLRSLSVIDMQFSGLTGRFPDFFANLSSLSVLQLSFNHLEGWVPPLIFQKKKLVAIDLHRNVGLSGTLPDFPVDSSLEILLVGHTNFSGTIPSFISNLKSLKKLGLDASGFSGELPSIIGTLRHLNSLQISGLEVVESFPKWITNLTSLEVLEFSNCGLHGTIPSSIADLTKL

ProfileScan: PS51450
IPR001611
296-318 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLQLSFNHLEGWVPPLIFQK

HMMPfam: PF13516
414-436 LRR_6,Leucine Rich repeat

LTSLEVLEFSNCGLHGTIPSSIA

Gene3D: G3DSA:3.80.10.10
442-551 G3DSA:3.80.10.10

TKLALYACNLFGEIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNH

superfamily: SSF52047
454-847 SSF52047,LRR

EIPRHIFNLTQLDTIFLHSNSFTGTVELASFLTLPNLFDLNLSHNKLTVINGESNSSLTSFPNIGYLGLSSCNMTRFPNILKHLNKNEVNGIDLSHNHIQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQNQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMIDSVNGTSVMEYKGDKKRVYQVTTVLTYKGSTMRID

ProfileScan: PS51450
IPR001611
489-510 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLFDLNLSHNKLTVINGESNSS

ProfileScan: PS51450
IPR001611
516-537 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIGYLGLSSCNMTRFPNILKHL

Gene3D: G3DSA:3.80.10.10
552-691 G3DSA:3.80.10.10

IQGAIPHWAWENWKDAQFFFLNLSHNEFTRVGHTIFPFGVEMLDLSFNKFEGPIPLPQNSGTVLDYSNNRFSSIPPNISTQLRDTAYFKASRNNISGDIPTSFCSNKLQFLDLSFNFFSGSIPPCLIEVAGALQVLNLKQ

ProfileScan: PS51450
IPR001611
611-632 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SGTVLDYSNNRFSSIPPNISTQ

ProfileScan: PS51450
IPR001611
658-680 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQFLDLSFNFFSGSIPPCLIEV

HMMPfam: PF00560
IPR001611
658-676 LRR_1
Leucine-rich repeat

KLQFLDLSFNFFSGSIPPC

ProfileScan: PS51450
IPR001611
683-705 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALQVLNLKQNQLHGELPHYFNES

Gene3D: G3DSA:3.80.10.10
692-812 G3DSA:3.80.10.10

NQLHGELPHYFNESCTLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIADYFPCWMSAFPRLQVLVLKSNKFFGQVAPSVGEDSSCEFPSLCILDLASNKFSGTLSEEWFTRLKSMMI

HMMPfam: PF12799
707-744 LRR_4,Leucine Rich repeats (2 copies)

TLEALDFSDNRIEGNLPRSIASCRKLEVLDIQNNHIAD

ProfileScan: PS51450
IPR001611
707-729 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLEALDFSDNRIEGNLPRSIASC

ProfileScan: PS51450
IPR001611
731-744 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEVLDIQNNHIAD

ProfileScan: PS51450
IPR001611
784-806 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLCILDLASNKFSGTLSEEWFTR

superfamily: SSF52058
850-982 SSF52058,LRR

LRTFVFIDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLSKGCDNMTLNVTLSDRKS

Gene3D: G3DSA:3.80.10.10
856-965 G3DSA:3.80.10.10

IDVSNNAFHGSVPKAIGELVLLNTLNMSHNSLTGPVPTQLSHLNQMEALDLSSNELSGVILQELASLHFLTTLNLSYNRLVGRIPESTQFSTFLNNSFLGNDGLCGPPLS

ProfileScan: PS51450
IPR001611
876-899 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLNTLNMSHNSLTGPVPTQLSHLN

ProfileScan: PS51450
IPR001611
900-923 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QMEALDLSSNELSGVILQELASLH

ProfileScan: PS51450
IPR001611
924-946 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLTTLNLSYNRLVGRIPESTQFS

HMMPfam: PF00560
IPR001611
925-942 LRR_1
Leucine-rich repeat

LTTLNLSYNRLVGRIPES


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox