PRGDB00048260 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGCCGGCCCCGTGCTTGCCCGACCAGGCAGCGGCGCTGCTCCGCCTGAAACATTCCTTCAACATGACCAACAAGTCCGAGTGCACCCTCGCATCATGGCGCGCCGGCACGGACTGCTGCCGCTGGGAGGGCGTCCGCTGCGGCGTCGGCATCGGCGTTGGCCATGTGACCTCGCTTGACCTCGGTGAGTGCGGATTGGAGAGCGCTGCTCTTGACCCTGCGCTTTTCGAGCTCACTTCGCTCAGGCACCTTAACCTCGCGTGGAACAATTTCAGCGGGTCTCATATTCCCACCATTGGGTTCGAACGGCTCACTGAGCTCACCTACCTCAATCTCTCCAACTCCAAATTTGCAGGCCAGATACCAAATACAATAGGACGTCTCACTAATTTGATATCCCTTGACCTCTCCACTGATTTTTTCCTTATTGATCTAGATGATGAGTTCTTATCAGTTGCCACCTATTCACCCGCTTGGTTACTTGTGGCACCAAACATTGTGTCAATAGTCGCAAACCTCCACAACCTGAAGGAACTTTATATGGGCACAATAGACTTGTCCAGCAACAGCATGGTACAGTGGTGCAGTGCCTTTTCAAACTCCACTACCCCTCAACTTCAGGTCCTTAGCTTACCATATTGCTACCTCGAGGTTCCCATTTGTGAATCATTGTCGGGTATACGCTCACTGAGTGAGATTAACCTACAGTACAACTTCATACACGGTCCCATTCCAGAGTCCTTTGGAGATTTACCTTCCCTAAGTGTTCTTAGTCTTACACACAACAGTCTAGAAGGGAGCTTCCCAAGTAGAATCTTCCAGAACAAAAACTTAACCTCTGTTGATGTTAGGTACAACTTCGAACTCTCCGGTTCGTTGCCAAAAAATATCTCATCAAATGACATTTTGGTAGATCTTCTTGTTAGCAGTACTAACTTCTCTGGTCCAATCCCTAACTCAGTAGGCAACATCAAATCCTTGGAAAATTTGGGTGTTGCATCAAGTGACTTCTCCCAAGAGCTTCCCTCTTCTATTGGCCAGCTGAGATCGTTGAATTCGTTAGAGATTACAGGGGCTGGTGTAGTAGGAGCAGTACCATCTTGGATTGCAAATTTGACTTCATTGACCCTTCTCGACTTCTCGAACTGTGGCTTATCTGGGAAGATACCATCTGCGATAGGTGCTATCAAGAATCTGAAGAGGTTAGCGTTATACAAATGTAACTTTTCTGGCCAAATACCTCAAGATCTATTTAACCTAACTCAATTGAGAGTCATATATCTTCAATATAATAACTTCATTGGTACGTTGGAGCTCAGCTCATTTTGGAAACTACCAGACCTATTTTCTTTGAATCTTTCCAACAACAAACTATCAGTTGTAGATGGTGAGAAAAATAATTCTTCATGGGTGTCCATAAACTATTTCTACACCTTGCGCCTAGCATATTGTAACATATCCAATTTCCCTAGTGCCTTGAGTCTCATGCCTTGGGTTGGAAATCTTGATCTTTCAGGAAATCAGATCCATGGTACTATACCTCAGTGGGCGTGGGAAACTTCGAGCGAGTTGTTTATCCTCAACTTATTACACAACAAATTCGACAATATAGGATATAATTATCTTCCATTTTACTTAGAGATTGTTGATCTCAGTTATAACTTATTCCAAGGACCCATACCTATAACTGGACCTGACACTTGGTTGCTCGATTGCTCAAACAACCGGTTCTCATCCATGCCATTTAACTTCAGTTCCCAGCTTAGTGGGATGTCCTATCTCATGGCCTCCAGAAACAACCTATCTGGAGAAATTCCACTCTCAATTTGTGATGCAAGGGACATTCTGCTCCTTGATCTTTCTTACAACAATTTAAGTGGCTTGATTCCACTTTGTTTACTGGAGGATATCAATTCCCTTAGTGTGTTCAACTTGAAAGCAAATCAACTTCATGGTGAGTTACCTCGTAATATCAAGAAAGGATGTGCATTAGAGGCATTAGATTTCAGTGAGAACATGTTTGAAGGACAACTACCCACATCTCTAGTTGCTTGCAGAGATTTGGAGGTTTTAGACATTGGAAATAATCAGATTAGCGGTGGTTTTCCATGTTGGGCTAGTATGCTTCCTAAACTTCAGGTTCTTGTCCTGAAGTCCAACAAGTTCACCGGAGAGGTGGGGTCTTCTGCCATCGAAAAAGATAACACTTGCGAATTTGCAAATCTACGGATTCTTGATTTGGCTTCAAACAACTTTTCTGGTACTCTACATCACAAGTGGTTGAAAAGGTTAAAATCCATGATGGAGACATCTTCTAGTGCGACATTGCTTATGCAATATCAGCACAACGTGCATAGTACAACATATCAGTTTTCTACTTCAATCGCATATAAAGGGTATGAAGTCACATTTACAAAAATCTTGAGGACCCTTGTAGTCATCGATGTTTCAGACAATGCACTCCATGGTAGCATTCCCAAGTCAATTGGAGAGCTCGTTCTCCTCCGTGGGCTAAACATGTCACATAATGCCCTCACAGGACCAATTCCATCTCAGCTTGGTGCTCTGCATGAACTCGAGTCATTGGACCTCTCATCAAATGATCTTTCAGGGGAGATTCCACAGGAGTTAGCACAGCTACACTTCCTCTCAGTGCTGAACCTGTCCTACAACGGTTTGGTTGGGAGAATACCAGATTCACCCCAGTTCTCGAACAATCTCTCCTATCTGGGGAACATTGGTCTATGTGGGTTTCCATTGTCCAAGGAATGCAGCAACATGACAACACCACCAAGCTCACATCCTTCAGAGGAAAAACATGTGGATGTTATACTGTTCCTCTTTGTTGGACTTGGAGTTGGCATCGGGTTTGCAGTTATAATCGTTGTGACATGGGGAATCCGCATCAAGAAAAGGTCCCAAGACAGCAGATTTCCGTTTTGGAAAAAAGTTCTCTGTATGTAA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MPAPCLPDQAAALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRIKKRSQDSRFPFWKKVLCM


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
4-151 G3DSA:3.80.10.10

PCLPDQAAALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLS

HMMPfam: PF08263
IPR013210
7-47 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRC

HMMPanther: PTHR26393:SF519
12-969 PTHR26393:SF519

ALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRI

HMMPanther: PTHR26393
12-969 PTHR26393,FAMILY NOT NAMED

ALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRI

superfamily: SSF52058
30-287 SSF52058,LRR

LASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNF

HMMPfam: PF13855
55-116 LRR_8,Leucine rich repeat

HVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSK

Gene3D: G3DSA:3.80.10.10
203-328 G3DSA:3.80.10.10

TPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLE

superfamily: SSF52047
219-545 SSF52047,LRR

PICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFY

Gene3D: G3DSA:3.80.10.10
329-554 G3DSA:3.80.10.10

NLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYN

HMMPfam: PF13516
372-394 LRR_6,Leucine Rich repeat

LTSLTLLDFSNCGLSGKIPSAIG

HMMPfam: PF13855
398-458 LRR_8,Leucine rich repeat

NLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKL

superfamily: SSF52047
546-911 SSF52047,LRR

LEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLG

Gene3D: G3DSA:3.80.10.10
555-771 G3DSA:3.80.10.10

LFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETS

FPrintScan: PR00019
615-628 LEURICHRPT,Leucine-rich repeat signature

ILLLDLSYNNLSGL

HMMPfam: PF13516
685-700 LRR_6,Leucine Rich repeat

CRDLEVLDIGNNQISG

HMMPfam: PF00560
IPR001611
741-763 LRR_1
Leucine-rich repeat

NLRILDLASNNFSGTLHHKWLKR

Gene3D: G3DSA:3.80.10.10
808-910 G3DSA:3.80.10.10

LRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYL

FPrintScan: PR00019
856-869 LEURICHRPT,Leucine-rich repeat signature

LHELESLDLSSNDL

HMMPfam: PF13516
859-879 LRR_6,Leucine Rich repeat

LESLDLSSNDLSGEIPQELAQ


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox