PRGDB00048261 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGCTGCTCCTTGTCCTGCTACAAATCCAGCTCGTCGCCGCGCTCTCGCTTCTCCCGCCGGCATCAGCACCACCGCCGGCCGCTCTCCCATGCCGTCCGGACCAGGAGTCACCGCTGCTCCGGCTGAAGAGCTCCTTCTCCGCCACCGACATGTCCACGGCGGCTTTCCGGTCATGGCGACCCGGCACGGACTGCTGCCGCTGGGACGGCGTCCGCTGTGGCCACGGCGACGGCCGCGTGACCTCCCTCGACCTGGGCGGCCGTCAGCTGGAGAGCAGAGGAGGCCTCGACCCAGCAATCTTCCATCTCACATCCCTCGAGTATCTTAGCCTCGCCGACAATGACTTCAACGGGTCTCCTCTCCCTTCCAGCGGCTTTGAGCGTCTCACAGAGCTCACCCATCTCAGCCTTCGCAGCACCAACATTACAGGCGTGGTACCAGCCGGAATCGGCCGTTTGGTGAATTTGGTATCCCTTGATCTCTCCACAGACTTTGAGATAATCGACACATTTGATGATGTCTATGTTTTTAAAATGAATTCGAGTCTCGATGCCCAACAGCTCGCTGTGCCAAACCTGGAAAGCTTAGTCGCAAACCTTAGCAATTTAAGGGAGCTCAACCTTGGCTTAGTAAACTTATCTGAAAATGGCGCCAGATGGTGCAACGCTCTAGTCGATTCCTGCCCAAAACTTCAGGTTCTTCGTTTGTCTTGCTGTGCTCTCTCTGGCCCAATATGTGCAACACTTCCCCGTTTGCACTCACTTTCTGTTATTGACCTATCGTTTAATAGTTTGCCCGGGCTAATTCCAGATTTCTCCAACTTTCCTAATTTGACTGCCCTCCAACTTAGACGTAATGACCTTGAAGGATTTGTCTCTCCATTGATCTTTAAGCACAAGAAACTAGTAACTATTGATCTTTACCATAATCCAGGAATATATGGTACTTTGCCAAACTTTTCATCTGATAGTCATTTGGAAAATATATATGTTGGTGGAACTGAATTCAATGGTATAATACCAAGTTCCATCGCTGAACTCAAATCTTTGAAGAATCTAGGCCTAGGAGCAACTGGCTTTTCTGGAGAACTGCCCTCATCAATTGGAAACCTCAGATCCTTGAAGTCATTAGAGATTTCCGGTTTTGGACTAGTAGGGTCCATACCATCATGGGTTGCGAACCTATCCTCTTTGACTGTGCTTCAGTTCACAAATTGTGGCTTATCTGGATCAATACCATCCTCTGTCGGTAACCTTAGGAATTTGGGAAAACTACTATTGTATAATTGCAGCTTTTCAGGAAAGATACCTTCACAAATCTTGAACTTAACACAGCTAGAAATACTCTCGCTTCATTCAAACAACTTCATTGGCACAGTAGAGCTTACCTCGATGTGGAAACTACTAGACCTGTTTGTCTTGGATCTTTCAGATAATAATCTGGTCGTTGTAGATGGAAAGGGTAATTCTTCAACGGCATCCATCCCCAAACTAGGAGCGTTACGTTTATCAGGTTGCAATGTTTCGAAATTCCCTAATTTCTTGAGGTTCCAAGATGAAATCGAATATCTTGATCTTTCATATAACCATATCGATGGAGCCATACCCCAATGGGCATGGGAGAATTGGGTCAAAATGGACATACTATCCTTGAAGAACAATAAGTTTACAAGTGTTGGGCATGACCCTTTTCTTCCTTTAAGTGATATGAAAGCACTTGATCTTAGTGAGAACATGTTTGAGGGGCCCATACCTATACCTCGAGGATATGCAACTGTGCTTGACTACTCAGGAAACAGGTTCTCATCTATACCATTTAAGTTTACCAATTATCTCAGTGATGTCTCGTTTTTCAAGGCCGGTAGAAACAATTTCTCTGGAAGAATTCCTCCATCCTTTTGTAGTGCAATGAGTTTACAGCTCCTTGATCTCTCATACAATAGCTTTGATGGTTCAATTCCTTCTTGTTTAATAGAGGATGTTGACAAACTGGAAGTATTAAATCTAAAAGAAAATAAGCTTCGTGGGGAATTTCCGGACAATATCAAGGAAAGTTGCTCATTTGAGGCACTGGATTTCAGTGGCAATTTGATTGAAGGGAAACTGCCAAGATCTCTGGCCGTTTGCAAAAACTTGGAGGTCCTTAATATTGGAAGCAATCAGATTAATGATTCCTTTCCATGTTGGATGGGCACACTTCGTAAACTTCAAGTTCTTGTGCTGAAATCAAACAAGTTTTTTGGGCATGTAGCACAGTCTCTGGGGGAAGAAAAAGGTACATGTGAATTTCAGAGCGCAAGAATTGTTGATCTAGCATCCAACAAGTTCTCTGGCATCTTGCCGCAAGAGTGGTTTAACAAGTTAAAGTCAATGATGATCAAAGATTCAAATTTGACATTGGTCATGGACCATGATCTCCCACGAATGGAGAAATATGATTTTACTGTTGCACTCACATACAAAGGGATGGACATCACATTTACTAAGATCTTGAGGACCCTTGTATTCATTGATTTATCAGATAACGCATTCCATGGCAGCCTACCTGAAGCTATAGGTGAACTTGTTCTGCTAAACGTGCTCAACATATCACACAACTCACTGACGGGGCCGATTCCACCTCAGCTTGGTCGTTTAACCCAGCTTGAGTCGTTGGACATCTCATCAAATGAGCTTTCAGGAGAAATCCCACAGCAGTTGGCATCCTTGGACTTCCTCACAGTGTTGAACCTGTCCTACAACAAGCTGGAGGGGGAAATACCAGAATCGCCTCATTTCTTGACATTCTCCAATAGTTCATTTCTGGGGAACGATGGTTTGTGCGGTCGTCCACTGTCGAAAGGATGCATCAACATTACATCTCTGAATGTGATCCCTTCCAAGAAGAATTCACTTGACGTTTTGCTATTCCTTTTTGCTGGATTGGGATTCGGCTTTGGATTTGCCCTTTCAATTGTGGTTATATGGGGAATTCCCATCAGAAAGCGGTCTCGAGTAAGGCAGAGAGCCCTCTGA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MLLLVLLQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393
7-1004 PTHR26393,FAMILY NOT NAMED

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

HMMPanther: PTHR26393:SF522
7-1004 PTHR26393:SF522

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

Gene3D: G3DSA:3.80.10.10
31-304 G3DSA:3.80.10.10

CRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVT

HMMPfam: PF08263
IPR013210
34-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRC

superfamily: SSF52047
82-433 SSF52047,LRR

SLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFS

HMMPfam: PF13855
229-288 LRR_8,Leucine rich repeat

PKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDL

Gene3D: G3DSA:3.80.10.10
305-485 G3DSA:3.80.10.10

IDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVD

superfamily: SSF52047
435-825 SSF52047,LRR

KIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDI

Gene3D: G3DSA:3.80.10.10
491-657 G3DSA:3.80.10.10

STASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCL

Gene3D: G3DSA:3.80.10.10
660-793 G3DSA:3.80.10.10

DVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMI

HMMPfam: PF13855
690-745 LRR_8,Leucine rich repeat

ALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNK

superfamily: SSF52058
763-945 SSF52058,LRR

FQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPL

Gene3D: G3DSA:3.80.10.10
837-946 G3DSA:3.80.10.10

IDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLS

HMMPfam: PF12799
858-893 LRR_4,Leucine Rich repeats (2 copies)

LNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELS

HMMPfam: PF00560
IPR001611
906-923 LRR_1
Leucine-rich repeat

LTVLNLSYNKLEGEIPES


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox