PRGDB00048261 (P0041E11.42)

From PRG Wiki
Jump to: navigation, search
P0041E11.42
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 8570044 (AP002521)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0041E11.

DNA Sequence

ATGCTGCTCCTTGTCCTGCTACAAATCCAGCTCGTCGCCGCGCTCTCGCTTCTCCCGCCGGCATCAGCACCACCGCCGGCCGCTCTCCCATGCCGTCCGGACCAGGAGTCACCGCTGCTCCGGCTGAAGAGCTCCTTCTCCGCCACCGACATGTCCACGGCGGCTTTCCGGTCATGGCGACCCGGCACGGACTGCTGCCGCTGGGACGGCGTCCGCTGTGGCCACGGCGACGGCCGCGTGACCTCCCTCGACCTGGGCGGCCGTCAGCTGGAGAGCAGAGGAGGCCTCGACCCAGCAATCTTCCATCTCACATCCCTCGAGTATCTTAGCCTCGCCGACAATGACTTCAACGGGTCTCCTCTCCCTTCCAGCGGCTTTGAGCGTCTCACAGAGCTCACCCATCTCAGCCTTCGCAGCACCAACATTACAGGCGTGGTACCAGCCGGAATCGGCCGTTTGGTGAATTTGGTATCCCTTGATCTCTCCACAGACTTTGAGATAATCGACACATTTGATGATGTCTATGTTTTTAAAATGAATTCGAGTCTCGATGCCCAACAGCTCGCTGTGCCAAACCTGGAAAGCTTAGTCGCAAACCTTAGCAATTTAAGGGAGCTCAACCTTGGCTTAGTAAACTTATCTGAAAATGGCGCCAGATGGTGCAACGCTCTAGTCGATTCCTGCCCAAAACTTCAGGTTCTTCGTTTGTCTTGCTGTGCTCTCTCTGGCCCAATATGTGCAACACTTCCCCGTTTGCACTCACTTTCTGTTATTGACCTATCGTTTAATAGTTTGCCCGGGCTAATTCCAGATTTCTCCAACTTTCCTAATTTGACTGCCCTCCAACTTAGACGTAATGACCTTGAAGGATTTGTCTCTCCATTGATCTTTAAGCACAAGAAACTAGTAACTATTGATCTTTACCATAATCCAGGAATATATGGTACTTTGCCAAACTTTTCATCTGATAGTCATTTGGAAAATATATATGTTGGTGGAACTGAATTCAATGGTATAATACCAAGTTCCATCGCTGAACTCAAATCTTTGAAGAATCTAGGCCTAGGAGCAACTGGCTTTTCTGGAGAACTGCCCTCATCAATTGGAAACCTCAGATCCTTGAAGTCATTAGAGATTTCCGGTTTTGGACTAGTAGGGTCCATACCATCATGGGTTGCGAACCTATCCTCTTTGACTGTGCTTCAGTTCACAAATTGTGGCTTATCTGGATCAATACCATCCTCTGTCGGTAACCTTAGGAATTTGGGAAAACTACTATTGTATAATTGCAGCTTTTCAGGAAAGATACCTTCACAAATCTTGAACTTAACACAGCTAGAAATACTCTCGCTTCATTCAAACAACTTCATTGGCACAGTAGAGCTTACCTCGATGTGGAAACTACTAGACCTGTTTGTCTTGGATCTTTCAGATAATAATCTGGTCGTTGTAGATGGAAAGGGTAATTCTTCAACGGCATCCATCCCCAAACTAGGAGCGTTACGTTTATCAGGTTGCAATGTTTCGAAATTCCCTAATTTCTTGAGGTTCCAAGATGAAATCGAATATCTTGATCTTTCATATAACCATATCGATGGAGCCATACCCCAATGGGCATGGGAGAATTGGGTCAAAATGGACATACTATCCTTGAAGAACAATAAGTTTACAAGTGTTGGGCATGACCCTTTTCTTCCTTTAAGTGATATGAAAGCACTTGATCTTAGTGAGAACATGTTTGAGGGGCCCATACCTATACCTCGAGGATATGCAACTGTGCTTGACTACTCAGGAAACAGGTTCTCATCTATACCATTTAAGTTTACCAATTATCTCAGTGATGTCTCGTTTTTCAAGGCCGGTAGAAACAATTTCTCTGGAAGAATTCCTCCATCCTTTTGTAGTGCAATGAGTTTACAGCTCCTTGATCTCTCATACAATAGCTTTGATGGTTCAATTCCTTCTTGTTTAATAGAGGATGTTGACAAACTGGAAGTATTAAATCTAAAAGAAAATAAGCTTCGTGGGGAATTTCCGGACAATATCAAGGAAAGTTGCTCATTTGAGGCACTGGATTTCAGTGGCAATTTGATTGAAGGGAAACTGCCAAGATCTCTGGCCGTTTGCAAAAACTTGGAGGTCCTTAATATTGGAAGCAATCAGATTAATGATTCCTTTCCATGTTGGATGGGCACACTTCGTAAACTTCAAGTTCTTGTGCTGAAATCAAACAAGTTTTTTGGGCATGTAGCACAGTCTCTGGGGGAAGAAAAAGGTACATGTGAATTTCAGAGCGCAAGAATTGTTGATCTAGCATCCAACAAGTTCTCTGGCATCTTGCCGCAAGAGTGGTTTAACAAGTTAAAGTCAATGATGATCAAAGATTCAAATTTGACATTGGTCATGGACCATGATCTCCCACGAATGGAGAAATATGATTTTACTGTTGCACTCACATACAAAGGGATGGACATCACATTTACTAAGATCTTGAGGACCCTTGTATTCATTGATTTATCAGATAACGCATTCCATGGCAGCCTACCTGAAGCTATAGGTGAACTTGTTCTGCTAAACGTGCTCAACATATCACACAACTCACTGACGGGGCCGATTCCACCTCAGCTTGGTCGTTTAACCCAGCTTGAGTCGTTGGACATCTCATCAAATGAGCTTTCAGGAGAAATCCCACAGCAGTTGGCATCCTTGGACTTCCTCACAGTGTTGAACCTGTCCTACAACAAGCTGGAGGGGGAAATACCAGAATCGCCTCATTTCTTGACATTCTCCAATAGTTCATTTCTGGGGAACGATGGTTTGTGCGGTCGTCCACTGTCGAAAGGATGCATCAACATTACATCTCTGAATGTGATCCCTTCCAAGAAGAATTCACTTGACGTTTTGCTATTCCTTTTTGCTGGATTGGGATTCGGCTTTGGATTTGCCCTTTCAATTGTGGTTATATGGGGAATTCCCATCAGAAAGCGGTCTCGAGTAAGGCAGAGAGCCCTCTGA


Protein sequences

Name Description Sequence
putative verticillium wilt disease resistance protein putative verticillium wilt disease resistance protein [Oryza sativa Japonica Group].

MLLLVLLQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393
7-1004 PTHR26393,FAMILY NOT NAMED

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

HMMPanther: PTHR26393:SF522
7-1004 PTHR26393:SF522

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

Gene3D: G3DSA:3.80.10.10
31-304 G3DSA:3.80.10.10

CRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVT

HMMPfam: PF08263
IPR013210
34-73 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRC

superfamily: SSF52047
82-433 SSF52047,LRR

SLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFS

HMMPfam: PF13855
229-288 LRR_8,Leucine rich repeat

PKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDL

Gene3D: G3DSA:3.80.10.10
305-485 G3DSA:3.80.10.10

IDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVD

superfamily: SSF52047
435-825 SSF52047,LRR

KIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDI

Gene3D: G3DSA:3.80.10.10
491-657 G3DSA:3.80.10.10

STASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCL

Gene3D: G3DSA:3.80.10.10
660-793 G3DSA:3.80.10.10

DVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMI

HMMPfam: PF13855
690-745 LRR_8,Leucine rich repeat

ALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNK

superfamily: SSF52058
763-945 SSF52058,LRR

FQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPL

Gene3D: G3DSA:3.80.10.10
837-946 G3DSA:3.80.10.10

IDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLS

HMMPfam: PF12799
858-893 LRR_4,Leucine Rich repeats (2 copies)

LNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELS

HMMPfam: PF00560
IPR001611
906-923 LRR_1
Leucine-rich repeat

LTVLNLSYNKLEGEIPES


List of References

Takuji Sasaki, Takashi Matsumoto, Kimiko Yamamoto, Katsumi Sakata, Tomoya Baba, Yuichi Katayose, Jianzhong Wu, Yoshihito Niimura, Zhukuan Cheng, Yoshiaki Nagamura, Baltazar A Antonio, Hiroyuki Kanamori, Satomi Hosokawa, Masatoshi Masukawa, Koji Arikawa, Yoshino Chiden, Mika Hayashi, Masako Okamoto, Tsuyu Ando, Hiroyoshi Aoki, Kohei Arita, Masao Hamada, Chizuko Harada, Saori Hijishita, Mikiko Honda, Yoko Ichikawa, Atsuko Idonuma, Masumi Iijima, Michiko Ikeda, Maiko Ikeno, Sachie Ito, Tomoko Ito, Yuichi Ito, Yukiyo Ito, Aki Iwabuchi, Kozue Kamiya, Wataru Karasawa, Satoshi Katagiri, Ari Kikuta, Noriko Kobayashi, Izumi Kono, Kayo Machita, Tomoko Maehara, Hiroshi Mizuno, Tatsumi Mizubayashi, Yoshiyuki Mukai, Hideki Nagasaki, Marina Nakashima, Yuko Nakama, Yumi Nakamichi, Mari Nakamura, Nobukazu Namiki, Manami Negishi, Isamu Ohta, Nozomi Ono, Shoko Saji, Kumiko Sakai, Michie Shibata, Takanori Shimokawa, Ayahiko Shomura, Jianyu Song, Yuka Takazaki, Kimihiro Terasawa, Kumiko Tsuji, Kazunori Waki, Harumi Yamagata, Hiroko Yamane, Shoji Yoshiki, Rie Yoshihara, Kazuko Yukawa, Huisun Zhong, Hisakazu Iwama, Toshinori Endo, Hidetaka Ito, Jang Ho Hahn, Ho-Il Kim, Moo-Young Eun, Masahiro Yano, Jiming Jiang, Takashi Gojobori
The genome sequence and structure of rice chromosome 1.
Nature: 2002, 420(6913);312-6
PubMed:12447438 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox