PRGDB00048275 (NBS/LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS/LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2656027 (AB009051)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone: MJH22.

DNA Sequence

ATGGGAGGTTGTGTCTCTGTATCAATATCATGTGATCAGTTGACGAAGAATGTTTGTAGTTGCTTAAACAGGAATGGAGATTACATTCATGGCTTAGAGGAGAATCTGACAGCTCTGCAGAGAGCTCTTGAGCAGATTGAGCAAAGACGAGAAGATTTGTTGAGAAAGATTTTGTCTGAAGAAAGACGAGGTTTACAACGACTTTCTGTTGTGCAAGGATGGGTTTCAAAAGTTGAAGCAATAGTACCTCGAGTTAACGAACTCGTCAGAATGAGATCTGTTCAAGTCCAAAGGTTGTGTCTTTGTGGGTTTTGTTCCAAGAATCTTGTCTCAAGCTACCGTTATGGGAAGAGAGTAATGAAGATGATAGAGGAAGTTGAGGTTCTTCGATATCAGGGAGATTTCGCTGTGGTGGCTGAGAGAGTTGATGCAGCAAGAGTGGAAGAGAGGCCTACTAGACCTATGGTTGCTATGGATCCAATGCTTGAGAGTGCGTGGAACCGTCTAATGGAAGATGAGATTGGGATTCTTGGTCTTCATGGTATGGGTGGAGTAGGTAAAACTACACTTCTCAGTCATATCAACAATAGATTCTCTAGAGTTGGGGGCGAGTTTGATATTGTGATTTGGATTGTGGTCTCCAAAGAGTTACAGATCCAGAGGATCCAAGATGAGATATGGGAGAAGTTACGGTCTGATAACGAGAAGTGGAAACAGAAAACAGAGGACATAAAAGCATCTAACATTTACAATGTGTTAAAGCACAAAAGGTTTGTCTTGTTATTGGATGACATATGGAGTAAAGTGGATTTAACAGAGGTGGGAGTTCCGTTTCCGAGTAGAGAAAACGGATGCAAAATAGTATTCACCACTCGGTTGAAAGAAATCTGCGGGCGGATGGGAGTTGATAGCGATATGGAAGTCCGGTGTTTAGCCCCGGATGATGCGTGGGATTTGTTTACTAAGAAAGTAGGAGAGATCACATTAGGGAGCCACCCTGAGATTCCCACAGTCGCAAGAACAGTTGCTAAGAAATGTCGCGGCCTACCATTGGCCCTTAACGTCATTGGTGAAACAATGGCATATAAAAGGACAGTGCAAGAATGGCGTTCAGCAATCGACGTTTTGACTTCATCTGCAGCTGAGTTTTCAGGTATGGAAGATGAGATTCTACCTATTCTAAAGTACAGCTATGATAATTTAAAAAGTGAACAGCTCAAATTGTGCTTCCAGTACTGTGCTTTGTTTCCAGAAGATCATAACATTGAGAAAAATGATTTGGTAGATTACTGGATAGGTGAGGGATTCATAGATAGAAACAAAGGTAAAGCTGAGAACCAAGGTTATGAAATTATCGGTATTCTAGTTCGTTCATGCTTATTGATGGAGGAGAATCAAGAAACGGTGAAGATGCATGATGTGGTCCGAGAAATGGCATTGTGGATAGCATCTGATTTTGGAAAGCAAAAAGAAAACTTTATAGTGCAAGCGGGCTTACAGTCGAGGAACATACCTGAGATCGAGAAGTGGAAAGTTGCGAGAAGGGTGTCATTGATGTTTAACAACATTGAAAGTATACGTGATGCTCCTGAATCTCCCCAACTTATAACTTTGCTCCTCCGAAAGAACTTCTTGGGGCATATCTCAAGCAGCTTCTTTCGGTTGATGCCAATGCTAGTTGTTCTTGATCTATCAATGAACAGGGATCTCAGACATTTGCCAAATGAAATATCAGAATGTGTCTCATTGCAGTATCTGAGCTTATCACGTACAAGGATAAGGATTTGGCCTGCTGGTTTAGTAGAGTTGAGGAAACTTTTATACCTGAATTTGGAGTACACAAGGATGGTAGAGAGTATCTGTGGCATATCAGGTTTAACAAGTTTGAAAGTGTTGAGATTATTTGTTTCCGGTTTCCCTGAAGATCCCTGTGTTTTGAACGAGTTGCAGCTTTTGGAAAACTTGCAAACTTTAACCATAACTCTTGGTCTTGCTTCTATTTTGGAACAATTCCTTAGCAACCAGAGGTTGGCAAGCTGTACACGAGCTCTGCGCATCGAGAATCTTAATCCGCAATCATCTGTAATCTCATTTGTTGCTACTATGGACAGTCTTCAAGAGCTTCATTTTGCAGACTCTGACATTTGGGAGATCAAGGTAAAGAGGAATGAGACGGTTTTGCCTCTGCACATCCCAACCACTACCACATTCTTCCCAAACCTCTCGCAAGTGTCTTTAGAATTCTGCACAAGATTGCGGGATTTGACGTGGCTGATCTTTGCTCCAAATCTTACGGTTCTACGAGTAATTTCAGCGAGTGACCTGAAAGAAGTAATAAACAAAGAGAAAGCTGAGCAGCAAAACCTTATTCCCTTCCAAGAACTAAAAGAGTTGCGGCTAGAAAATGTTCAGATGCTAAAACACATCCACCGGGGTCCCCTGCCATTTCCCTGTTTACAGAAAATTTTGGTTAATGGATGCTCAGAGCTGAGAAAACTTCCACTCAATTTCACGAGTGTCCCAAGAGGTGATCTTGTCATAGAGGCACATAAAAAATGGATAGAAATCCTTGAATGGGAAGATGAAGCCACCAAAGCCCGTTTCTTGCCTACACTCAAGGTTCTTTCTCTCGCATTTATCTGCCAAAACTTCTTTTTAATTATTCATTCCTTTGGATCTTACTCTCTTTTTTGGATGTTTTAG


Protein sequences

Name Description Sequence
NBS/LRR disease resistance protein NBS/LRR disease resistance protein [Arabidopsis thaliana].

MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKILSEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKRVMKMIEEVEVLRYQGDFAVVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKVLSLAFICQNFFLIIHSFGSYSLFWMF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-894 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKILSEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKRVMKMIEEVEVLRYQGDFAVVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKVLSLAFICQNFFLIIHSFGSY

HMMPanther: PTHR23155:SF108
1-894 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MGGCVSVSISCDQLTKNVCSCLNRNGDYIHGLEENLTALQRALEQIEQRREDLLRKILSEERRGLQRLSVVQGWVSKVEAIVPRVNELVRMRSVQVQRLCLCGFCSKNLVSSYRYGKRVMKMIEEVEVLRYQGDFAVVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRNKGKAENQGYEIIGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKVLSLAFICQNFFLIIHSFGSY

Coil: coil
29-64 coiled-coil

IHGLEENLTALQRALEQIEQRREDLLRKILSEERRG

Seg: seg
136-150 seg

AVVAERVDAARVEER

superfamily: SSF52540
137-382 P-loop containing nucleoside triphosphate hydrolases

VVAERVDAARVEERPTRPMVAMDPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAE

HMMPfam: PF00931
IPR002182
160-440 NB-ARC,NBS
NB-ARC

PMLESAWNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWSKVDLTEVGVPFPSRENGCKIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSHPEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILPILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFIDRN

Gene3D: G3DSA:3.40.50.300
166-267 no description

WNRLMEDEIGILGLHGMGGVGKTTLLSHINNRFSRVGGEFDIVIWIVVSKELQIQRIQDEIWEKLRSDNEKWKQKTEDIKASNIYNVLKHKRFVLLLDDIWS

Seg: seg
174-186 seg

IGILGLHGMGGVG

FPrintScan: PR00364
IPR000767
176-191 DISEASERSIST
Disease resistance protein

ILGLHGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
252-266 DISEASERSIST
Disease resistance protein

VLKHKRFVLLLDDIW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
470-877 L domain-like,LRR

KMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKVLSL

Gene3D: G3DSA:3.80.10.10
500-837 no description

QSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRMVESICGISGLTSLKVLRLFVSGFPEDPCVLNELQLLENLQTLTITLGLASILEQFLSNQRLASCTRALRIENLNPQSSVISFVATMDSLQELHFADSDIWEIKVKRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVINKEKAEQQNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLPLNF

HMMPfam: PF13855
533-593 LRR_8,Leucine rich repeat

PQLITLLLRKNFLGHISSSFFRLMPMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRI

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

RLMPMLVVLDLSMNRDL

Seg: seg
646-659 seg

LNELQLLENLQTLT


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox