PRGDB00048278 (putative TIR-NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative TIR-NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 158668041 (EU196036)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Coffea arabica

Comment?

Coffea arabica clone VIIP1_C5 putative TIR-NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

GCTCTCTACAATAAACTTGCTAGACACTTTCAATGCCGCAGCTTCCTTTCCAGTGTTAGAGAAAATTTTAAAAGTCGGCAAAATGGTCCTGAATTCCTTCAGAAAAAGATTGTTGGTGATCTTTCTTCACACAAGGTGCCTCCTACTTTCTCTGATGCCAAATCTTATGTGCTAGAAATGAAGAGGATACTGAAACAAAACCGAGTTCTTCTAGTTTTAGATGACATTGATGATGCGGGACAACTTAAAGAACTAGCTGGCTCGAGAGAATGGTACTCTGAAGGAAGCCGGATAGTAATTACTACTAGAGATGCGGCAGTTTTACCAACTGATTTTGTGGACAAGATTTATGAAGTGAAATCTTTGGGAAAGTCTGAGTCACTAAAACTTTTTAGTCACCATGCATTTAGAAGAGAGAATCCCACAGGAGCTTTCCTTAATTTGTCCAAAGAAATTGTCTCCTGTACCGGTGGACTACCGTTGGCACTAGAAGTCTTTGGTTCTCTTTTATACGGTAAGAGAATAGTAGAGGAATGGCAAGATGCTTTGGCAAAGCTGAAACAGATCCGTGGGCCTGAACTTCAGGGTGTCTTGAAGATAAGTTATGATGCCCTTGATGTTCAAGAGCGGTCGATATTCCTC


Protein sequences

Name Description Sequence
putative TIR-NBS-LRR disease resistance protein putative TIR-NBS-LRR disease resistance protein [Coffea arabica].

ALYNKLARHFQCRSFLSSVRENFKSRQNGPEFLQKKIVGDLSSHKVPPTFSDAKSYVLEMKRILKQNRVLLVLDDIDDAGQLKELAGSREWYSEGSRIVITTRDAAVLPTDFVDKIYEVKSLGKSESLKLFSHHAFRRENPTGAFLNLSKEIVSCTGGLPLALEVFGSLLYGKRIVEEWQDALAKLKQIRGPELQGVLKISYDALDVQERSIFL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-214 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ALYNKLARHFQCRSFLSSVRENFKSRQNGPEFLQKKIVGDLSSHKVPPTFSDAKSYVLEMKRILKQNRVLLVLDDIDDAGQLKELAGSREWYSEGSRIVITTRDAAVLPTDFVDKIYEVKSLGKSESLKLFSHHAFRRENPTGAFLNLSKEIVSCTGGLPLALEVFGSLLYGKRIVEEWQDALAKLKQIRGPELQGVLKISYDALDVQERSIFL

HMMPanther: PTHR11017:SF20
1-214 PTHR11017:SF20,SUBFAMILY NOT NAMED

ALYNKLARHFQCRSFLSSVRENFKSRQNGPEFLQKKIVGDLSSHKVPPTFSDAKSYVLEMKRILKQNRVLLVLDDIDDAGQLKELAGSREWYSEGSRIVITTRDAAVLPTDFVDKIYEVKSLGKSESLKLFSHHAFRRENPTGAFLNLSKEIVSCTGGLPLALEVFGSLLYGKRIVEEWQDALAKLKQIRGPELQGVLKISYDALDVQERSIFL

superfamily: SSF52540
1-194 SSF52540

ALYNKLARHFQCRSFLSSVRENFKSRQNGPEFLQKKIVGDLSSHKVPPTFSDAKSYVLEMKRILKQNRVLLVLDDIDDAGQLKELAGSREWYSEGSRIVITTRDAAVLPTDFVDKIYEVKSLGKSESLKLFSHHAFRRENPTGAFLNLSKEIVSCTGGLPLALEVFGSLLYGKRIVEEWQDALAKLKQIRGPEL

HMMPfam: PF00931
IPR002182
6-213 NB-ARC,NBS
NB-ARC

LARHFQCRSFLSSVRENFKSRQNGPEFLQKKIVGDLSSHKVPPTFSDAKSYVLEMKRILKQNRVLLVLDDIDDAGQLKELAGSREWYSEGSRIVITTRDAAVLPTDFVDKIYEVKSLGKSESLKLFSHHAFRRENPTGAFLNLSKEIVSCTGGLPLALEVFGSLLYGKRIVEEWQDALAKLKQIRGPELQGVLKISYDALDVQERSIF

FPrintScan: PR00364
IPR000767
63-77 DISEASERSIST
Disease resistance protein

ILKQNRVLLVLDDID

FPrintScan: PR00364
IPR000767
156-170 DISEASERSIST
Disease resistance protein

TGGLPLALEVFGSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox