PRGDB00048281 (putative TIR-NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative TIR-NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 158668035 (EU196033)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Coffea arabica

Comment?

Coffea arabica clone VIIP2_211 putative TIR-NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

GCTGTTTTTGACAGAATTTCCACTCATTTTGAAGGTGCTATCTTTCTTCATGAAGTCAGAGAACATTCTAAAAGATATGGTCTGGAAAATTTGCAAGAGAAGATTCTTTCTGAAATTCTGCGCATAAAAGAATTGAGGATCAACAATGTTTTTGAAGGATCAAATATGATAAAGAAAAGACTATGCTACAAAAAAGTCCTCATTGTTCTTGATGATATTGACCATCTCGATCAGTTAGAAGCTTTAGCTGGAAAGCATGATTGGTTCGGTAAAGGTAGCAGAATTATCATAACAACGAAAGATAAGCATTTGCTTGTTAAACATGACATAGACAGAATGTACAAGGTGGAAGTGTTGGATAAGTATGAAGCTGTGCAGCTGTTTAGTTGGAATGCTTTTAAGAAGAACTGTCCAGCAAAAGACTATGAGGAGCTTTCATTACAAATAGTGCATTATGCTGGTGGCCTTCCCTTGGCTCTAAAGATTTTGGGTAGCTTTCTGTATGGCGGAGACATGACTGAATGGAGAAGTGAAGTGGAGAGACTAAAAAAAATTCCAGAAGATGATATTATGAAAAAACTCACGGTAAGTTTCGATGGCCTTCAAAGAATTGAAAAAGAAATTTTCCTCGACATCGCCTGCTTCA


Protein sequences

Name Description Sequence
putative TIR-NBS-LRR disease resistance protein putative TIR-NBS-LRR disease resistance protein [Coffea arabica].

AVFDRISTHFEGAIFLHEVREHSKRYGLENLQEKILSEILRIKELRINNVFEGSNMIKKRLCYKKVLIVLDDIDHLDQLEALAGKHDWFGKGSRIIITTKDKHLLVKHDIDRMYKVEVLDKYEAVQLFSWNAFKKNCPAKDYEELSLQIVHYAGGLPLALKILGSFLYGGDMTEWRSEVERLKKIPEDDIMKKLTVSFDGLQRIEKEIFLDIACF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-215 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AVFDRISTHFEGAIFLHEVREHSKRYGLENLQEKILSEILRIKELRINNVFEGSNMIKKRLCYKKVLIVLDDIDHLDQLEALAGKHDWFGKGSRIIITTKDKHLLVKHDIDRMYKVEVLDKYEAVQLFSWNAFKKNCPAKDYEELSLQIVHYAGGLPLALKILGSFLYGGDMTEWRSEVERLKKIPEDDIMKKLTVSFDGLQRIEKEIFLDIACF

HMMPanther: PTHR11017:SF20
1-215 PTHR11017:SF20,SUBFAMILY NOT NAMED

AVFDRISTHFEGAIFLHEVREHSKRYGLENLQEKILSEILRIKELRINNVFEGSNMIKKRLCYKKVLIVLDDIDHLDQLEALAGKHDWFGKGSRIIITTKDKHLLVKHDIDRMYKVEVLDKYEAVQLFSWNAFKKNCPAKDYEELSLQIVHYAGGLPLALKILGSFLYGGDMTEWRSEVERLKKIPEDDIMKKLTVSFDGLQRIEKEIFLDIACF

HMMPfam: PF00931
IPR002182
5-215 NB-ARC,NBS
NB-ARC

RISTHFEGAIFLHEVREHSKRYGLENLQEKILSEILRIKELRINNVFEGSNMIKKRLCYKKVLIVLDDIDHLDQLEALAGKHDWFGKGSRIIITTKDKHLLVKHDIDRMYKVEVLDKYEAVQLFSWNAFKKNCPAKDYEELSLQIVHYAGGLPLALKILGSFLYGGDMTEWRSEVERLKKIPEDDIMKKLTVSFDGLQRIEKEIFLDIACF

superfamily: SSF52540
23-190 SSF52540

SKRYGLENLQEKILSEILRIKELRINNVFEGSNMIKKRLCYKKVLIVLDDIDHLDQLEALAGKHDWFGKGSRIIITTKDKHLLVKHDIDRMYKVEVLDKYEAVQLFSWNAFKKNCPAKDYEELSLQIVHYAGGLPLALKILGSFLYGGDMTEWRSEVERLKKIPEDDI

Gene3D: G3DSA:3.40.50.300
25-110 G3DSA:3.40.50.300

RYGLENLQEKILSEILRIKELRINNVFEGSNMIKKRLCYKKVLIVLDDIDHLDQLEALAGKHDWFGKGSRIIITTKDKHLLVKHDI

FPrintScan: PR00364
IPR000767
60-74 DISEASERSIST
Disease resistance protein

RLCYKKVLIVLDDID

FPrintScan: PR00364
IPR000767
153-167 DISEASERSIST
Disease resistance protein

AGGLPLALKILGSFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox