PRGDB00048320 (putative TIR-NBS-LRR class disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative TIR-NBS-LRR class disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 148807170 (EF640680)
Gene Class T
Domain Type TIR, LRR
Gene Species Prunus dulcis

Comment?

Prunus dulcis clone Pdbcs-L27 putative TIR-NBS-LRR class disease resistance protein mRNA, partial cds.

DNA Sequence

ACGCTTGAAAGTGGGACAGCTGTTTCTTCGGGGCTCTTCAACGCAATCAAAGAATCAAGGCTTGCAATCGTTGTTCTCTCGCCAAATTATGCTTCTTCTTCCTTGTGCTTGGATGAGCTTACAGAGATTCTCCAATGCATGAAATCCAAGGGCACAATTCTGCCAGTGTTTTATCATGTGGAACCCTCCGATGTGAGAAAACAAAGTGGCAGTTTTGCGGACGTCTTCGCTAAGCTTGAGGAAAGGTTTAGGGAAGACATAGAAAGGGTGAAGAGCTGGAGAGCTGCTTTAACTGAAGTGGCCAGTTTATCTGGGCTTGATTCAAAGAATGAGTCTGAAAGAAAGCTTATTGAATATATTGTTGAATGGGCGTGGGAGAAAGTGGGAATGAAGGCTACTTCAGAAAAGTGGATCTTTTTACTCATTTCCCTCTGCCTAGAGATTTTGTCGATTGCTTGTGATCAGGCTTCCTCTCCAAGAAATCCCCACTACGCATTATTTGGTATGATGTTGGCCATTGCTGCCGT


Protein sequences

Name Description Sequence
putative TIR-NBS-LRR class disease resistance protein putative TIR-NBS-LRR class disease resistance protein [Prunus dulcis].

TLESGTAVSSGLFNAIKESRLAIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAALTEVASLSGLDSKNESERKLIEYIVEWAWEKVGMKATSEKWIFLLISLCLEILSIACDQASSPRNPHYALFGMMLAIAAV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-103 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TLESGTAVSSGLFNAIKESRLAIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAALTEVASL

Gene3D: G3DSA:3.40.50.10140
2-97 G3DSA:3.40.50.10140

LESGTAVSSGLFNAIKESRLAIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAAL

superfamily: SSF52200
IPR000157
2-106 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LESGTAVSSGLFNAIKESRLAIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAALTEVASLSGL

HMMPfam: PF01582
IPR000157
3-98 TIR
Toll/interleukin-1 receptor homology (TIR) domain

ESGTAVSSGLFNAIKESRLAIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAALT

HMMPanther: PTHR23155:SF344
22-143 PTHR23155:SF344

AIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAALTEVASLSGLDSKNESERKLIEYIVEWAWEKVGMKATSEKWIFLLIS

HMMPanther: PTHR23155
22-143 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AIVVLSPNYASSSLCLDELTEILQCMKSKGTILPVFYHVEPSDVRKQSGSFADVFAKLEERFREDIERVKSWRAALTEVASLSGLDSKNESERKLIEYIVEWAWEKVGMKATSEKWIFLLIS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox