PRGDB00048326 (NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 149929300 (EF641122)
Gene Class NL
Domain Type NBS, LRR
Gene Species Ipomoea batatas

Comment?

Ipomoea batatas clone 169-01 NBS-LRR type disease resistance protein gene, partial cds.

DNA Sequence

GGTGGGGTTGGGAAGACAACACTAGCTAAAAAAGTCTACGATGATCCACTTATTATGTCTCAATTCGACACTCGAGCATGGGCGGTTGTGTCTCAAGAATACCAATATAAAGAGATGCTCATACACCTTTTACATTGCACCGATCCAACAACCACCAAGCTTTACAGTGAGGATTGTGGTAAGCTAAAAGCCGAACTGCGCAAACGTTTGTTGGGCAGAAGGTATTTGCTTGTCATAGATGACATATGGAGCCATGAGCCGTGGGATCAAATCTTTCAGTGTTTTCCCAACAATATCAATGGAAGTCGAATCCTGATCACTACACGAGAGAAAACTGAGGCTGAATACGCAGTACAATCAAGTGAGGGTAGGTATATTCATTCCTCACGTTTTCTAGACACACAGGAAAGTCGGGATCTATTTGAGACAAAGGTGTTTGGGGGAAAACATTCCTGCAAGCCTGAGTTTGAGCCAATTGGAAGATGTATTGTTAAGAAATGCCAAGGATTGCCACTAGCGTGG


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Ipomoea batatas].

GGVGKTTLAKKVYDDPLIMSQFDTRAWAVVSQEYQYKEMLIHLLHCTDPTTTKLYSEDCGKLKAELRKRLLGRRYLLVIDDIWSHEPWDQIFQCFPNNINGSRILITTREKTEAEYAVQSSEGRYIHSSRFLDTQESRDLFETKVFGGKHSCKPEFEPIGRCIVKKCQGLPLAW


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-173 NB-ARC,NBS
NB-ARC

GGVGKTTLAKKVYDDPLIMSQFDTRAWAVVSQEYQYKEMLIHLLHCTDPTTTKLYSEDCGKLKAELRKRLLGRRYLLVIDDIWSHEPWDQIFQCFPNNINGSRILITTREKTEAEYAVQSSEGRYIHSSRFLDTQESRDLFETKVFGGKHSCKPEFEPIGRCIVKKCQGLPLA

HMMPanther: PTHR11017:SF20
1-173 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGVGKTTLAKKVYDDPLIMSQFDTRAWAVVSQEYQYKEMLIHLLHCTDPTTTKLYSEDCGKLKAELRKRLLGRRYLLVIDDIWSHEPWDQIFQCFPNNINGSRILITTREKTEAEYAVQSSEGRYIHSSRFLDTQESRDLFETKVFGGKHSCKPEFEPIGRCIVKKCQGLPLA

HMMPanther: PTHR11017
1-173 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAKKVYDDPLIMSQFDTRAWAVVSQEYQYKEMLIHLLHCTDPTTTKLYSEDCGKLKAELRKRLLGRRYLLVIDDIWSHEPWDQIFQCFPNNINGSRILITTREKTEAEYAVQSSEGRYIHSSRFLDTQESRDLFETKVFGGKHSCKPEFEPIGRCIVKKCQGLPLA

superfamily: SSF52540
1-174 SSF52540

GGVGKTTLAKKVYDDPLIMSQFDTRAWAVVSQEYQYKEMLIHLLHCTDPTTTKLYSEDCGKLKAELRKRLLGRRYLLVIDDIWSHEPWDQIFQCFPNNINGSRILITTREKTEAEYAVQSSEGRYIHSSRFLDTQESRDLFETKVFGGKHSCKPEFEPIGRCIVKKCQGLPLAW

Gene3D: G3DSA:3.40.50.300
2-115 G3DSA:3.40.50.300

GVGKTTLAKKVYDDPLIMSQFDTRAWAVVSQEYQYKEMLIHLLHCTDPTTTKLYSEDCGKLKAELRKRLLGRRYLLVIDDIWSHEPWDQIFQCFPNNINGSRILITTREKTEAE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox