PRGDB00048328 (NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 149929293 (EF641117)
Gene Class N
Domain Type NBS
Gene Species Ipomoea batatas

Comment?

Ipomoea batatas clone 79-02 NBS-LRR type disease resistance protein gene, partial cds.

DNA Sequence

GGTGGGGTTGGGAAGACAACTAAAATATTGCTTGGCGTTGCGGGCAAATGTATCCAAAATGAGTCTCATCTCACTAAAGCAGTTTATGATGACTCTTTTATTGAGCATTACTTTAAGTTACAAGATGAAATTATCAAAACTGTAGGTCTTACAATTTATGAGGAGAATGAAGAGCAAAGGGCTGCTATTTTACACAACCACTTAGTGAGGAATAATGTGCTCGTTTTGGATGATAAATTGGGTGTCCCCCTTATGGTTAAGGGTTGCAAGCTCATTTTAACTACTCAATCACTAGATGTGTGTAGTGTGGGACAATATTCATTTGGAGGTAGGATTGGATGTCAAAATTTGTTCAAAGTTAATGTTCTTGATGAGGAGGAAGCTTGGAATTTGTTCAAGGAGATCTTTTTACAAGATGGTCATACTGTGCTCACCCATACTATTGGAAAACATGCCAAAGAATTGACCAAAAAGTGTGGGGGCTTACCATTGGCACTCAACATGCTGGTAAGCTACAAGCCGAAGGTGAATGATGATCGCATTTGGAGGAATGCCATTAAGAATTTCCAAAATGCTTCTCTTCAAATGGAAGACTTGGAAAATAATGTGTTTGAAATACTCAAATTTAGCTACGACAGATTGACTGATCCAAGTTTGAAGATCGAGTTATTAAAATTAGCTTGCAACCCTAGACCCAATAGGGGACACCCAATTTCTCCAAACGAATGTTGTCCCACACATCATCCAATAAGTGAAGATATAGACGAGGGTCATTCCATATTGAACTAG


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein NBS-LRR type disease resistance protein [Ipomoea batatas].

GGVGKTTKILLGVAGKCIQNESHLTKAVYDDSFIEHYFKLQDEIIKTVGLTIYEENEEQRAAILHNHLVRNNVLVLDDKLGVPLMVKGCKLILTTQSLDVCSVGQYSFGGRIGCQNLFKVNVLDEEEAWNLFKEIFLQDGHTVLTHTIGKHAKELTKKCGGLPLALNMLVSYKPKVNDDRIWRNAIKNFQNASLQMEDLENNVFEILKFSYDRLTDPSLKIELLKLACNPRPNRGHPISPNECCPTHHPISEDIDEGHSILN


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-169 SSF52540

GGVGKTTKILLGVAGKCIQNESHLTKAVYDDSFIEHYFKLQDEIIKTVGLTIYEENEEQRAAILHNHLVRNNVLVLDDKLGVPLMVKGCKLILTTQSLDVCSVGQYSFGGRIGCQNLFKVNVLDEEEAWNLFKEIFLQDGHTVLTHTIGKHAKELTKKCGGLPLALNML

HMMPfam: PF00931
IPR002182
1-230 NB-ARC,NBS
NB-ARC

GGVGKTTKILLGVAGKCIQNESHLTKAVYDDSFIEHYFKLQDEIIKTVGLTIYEENEEQRAAILHNHLVRNNVLVLDDKLGVPLMVKGCKLILTTQSLDVCSVGQYSFGGRIGCQNLFKVNVLDEEEAWNLFKEIFLQDGHTVLTHTIGKHAKELTKKCGGLPLALNMLVSYKPKVNDDRIWRNAIKNFQNASLQMEDLENNVFEILKFSYDRLTDPSLKIELLKLACNP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox