PRGDB00048331 (nbs-lrr disease resistance protein)

From PRG Wiki
Jump to: navigation, search
nbs-lrr disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 149392286 (EF576391)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) clone OSS-97-192-F11 nbs-lrr disease resistance protein mRNA, partial cds.

DNA Sequence

CACTATAGAGGGGAACAACATTTCAGGCACGATTGTGGTTTTGTTATTTCCTTTTTGGTGTGCACACGAGGTGTTTGCTATAATGTCTGAAGAGCTTGTGTATACATGGTTGGTTCAACATTATGTGTTAGTCATATTTTATATCGTTGCTGCCTATCACATAGTGCAGGAGTAA


Protein sequences

Name Description Sequence
nbs-lrr disease resistance protein nbs-lrr disease resistance protein [Oryza sativa (indica cultivar-group)].

TIEGNNISGTIVVLLFPFWCAHEVFAIMSEELVYTWLVQHYVLVIFYIVAAYHIVQE







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox