PRGDB00048332 (disease resistance protein rpm1)

From PRG Wiki
Jump to: navigation, search
disease resistance protein rpm1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 149391712 (EF576225)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) clone OSR-97-192-D7 disease resistance protein rpm1 mRNA, partial cds.

DNA Sequence

GGATTGACAACATAAGTGCTGCTGACTGTGCAAATCTTTTTGCTACACTATCAAAGATGCCGCTTCTTTCTAGCTTGCTTCTATCCGCAAGTCACGAGAAGGAGACACTTTGCTTGGAAAATCTCAAGCCAAGTTCGGAAAATCTCCATAGGTTGATTATCAGAGGGTGCTGGGCAGCTGGGACACTACAGTCCCCAATATTTCGTGACCATGGGAAATTTCTCAAGTATCTGGCCATAAGCTGGTGCCATCTTCAGGAAGATTCTCTACTCCTCCTAGCACCACATGTGCCAAACCTCACCTATCTTAAACTTAACAGGGTAAGTAGTGCAAGCAGCTTGGTTCTTTCTGCAGGTTGCTTCCCACAGCTGAAGACGCTCGCCTTGAAGCGTATGCCTGATGTAAACCACTTGGAGATCATAAGCGGTGCCCTCCAGCATATTGAAGGTTTATATGTAGTGTCACTCCCAAAGCTGGACACTATCCCTGAAGGCATTGAGTCCCTTAGGTACCTGAAGAAGCTGTGGCTTTTGGGTCTGCATAAGAATTTCAGATCTCAGTGGGAAAAAAATGGAATGCAACAAAAGATGCAACATGTTCCAGAGTTGCGTGTCAAGGACTAG


Protein sequences

Name Description Sequence
disease resistance protein rpm1 disease resistance protein rpm1 [Oryza sativa (indica cultivar-group)].

IDNISAADCANLFATLSKMPLLSSLLLSASHEKETLCLENLKPSSENLHRLIIRGCWAAGTLQSPIFRDHGKFLKYLAISWCHLQEDSLLLLAPHVPNLTYLKLNRVSSASSLVLSAGCFPQLKTLALKRMPDVNHLEIISGALQHIEGLYVVSLPKLDTIPEGIESLRYLKKLWLLGLHKNFRSQWEKNGMQQKMQHVPELRVKD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF199
1-204 PTHR23155:SF199,OS11G0229500 PROTEIN

IDNISAADCANLFATLSKMPLLSSLLLSASHEKETLCLENLKPSSENLHRLIIRGCWAAGTLQSPIFRDHGKFLKYLAISWCHLQEDSLLLLAPHVPNLTYLKLNRVSSASSLVLSAGCFPQLKTLALKRMPDVNHLEIISGALQHIEGLYVVSLPKLDTIPEGIESLRYLKKLWLLGLHKNFRSQWEKNGMQQKMQHVPELRV

HMMPanther: PTHR23155
1-204 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IDNISAADCANLFATLSKMPLLSSLLLSASHEKETLCLENLKPSSENLHRLIIRGCWAAGTLQSPIFRDHGKFLKYLAISWCHLQEDSLLLLAPHVPNLTYLKLNRVSSASSLVLSAGCFPQLKTLALKRMPDVNHLEIISGALQHIEGLYVVSLPKLDTIPEGIESLRYLKKLWLLGLHKNFRSQWEKNGMQQKMQHVPELRV

superfamily: SSF52047
13-179 SSF52047,LRR

FATLSKMPLLSSLLLSASHEKETLCLENLKPSSENLHRLIIRGCWAAGTLQSPIFRDHGKFLKYLAISWCHLQEDSLLLLAPHVPNLTYLKLNRVSSASSLVLSAGCFPQLKTLALKRMPDVNHLEIISGALQHIEGLYVVSLPKLDTIPEGIESLRYLKKLWLLGL

Gene3D: G3DSA:3.80.10.10
16-179 G3DSA:3.80.10.10

LSKMPLLSSLLLSASHEKETLCLENLKPSSENLHRLIIRGCWAAGTLQSPIFRDHGKFLKYLAISWCHLQEDSLLLLAPHVPNLTYLKLNRVSSASSLVLSAGCFPQLKTLALKRMPDVNHLEIISGALQHIEGLYVVSLPKLDTIPEGIESLRYLKKLWLLGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox