PRGDB00048335 (putative disease resistence protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistence protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942512 (EF514213)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig r1, complete sequence.

DNA Sequence

ATGTTGTATTTCAACAATGAATTGTCTGCTCTGAAAGATCATCTCCTTAGAAAGCTGCAATATTACACTACCTCGTATGCTGTAAGGGATCGAATAAATTTCATTCTATGGGAGTTAAAATTCCTTGATTGTTTTCTCTATTTGAAAAGGTTACCTTTTGCAAGTGAATGCGGTATGCTAAATGTGTCACAGAAAATGTTAGAAATTTGGAAAAGTCGGTGGAACAAGTTAATTTATATATGTATGTATGATCAAGAAGGTAGTCCTTGGGATGCAATTGTCTACTGGAAGGAGTTAATTTGGCATACTAAGCAAGAATTCAGAGCCCAATACTCCTTTCCGAAATCACCACTTGCAGCCAACGAGGTGATTGATGATGATGATAATACTCATAGCCCCGAATTTGTGATGGAAGTCATCGATGTTTTTGTGGGGAACATCAATGTTCTAGTGAAGATCAATGATCCATGGTCGTGCTTTTTTGTTCCAGGACTCAAGGAACAAATAGAACGAGTGTTAAAGGAGTTGAAGTTATTGAGATTTTTTGTCTGCTTTGTTTCAAACAAATGTATAGAGCCTCAATACCGATGTACTACTTTTTATACTCATGCTTTAATTGAGGCTAGCTATATCGCAATGGTTGTGTGGTTGCATTTGCCAATCTATGGCAGCAGAAATCAAGACTTGGCTCCAAGTGAAGTCAGTCGTTTGCTTTCTGATTTCATGGAAATGAAAATTAAGTCCATTGAGCCAGGCATCAGCCGCAACAGTATTTATATTGATGTCCTGCAAGCTTTGAAGTCCACCATACCACAAGCACAAAAGAAGCATGTGGAGATTCCAACACACAGTCTGACGGTTGGTTTGAGTGATCAAATGGCTAACCTTCAGGAGATGCTCTGCCTTCTAAGAGACAATCTCATTCATCTGCCAATACTAGATCTGGAATTTCATCTTCAAGATATGGATTCTGTTATTGTTGATGCCGGACTTCTTATTTACTCATTATATGATATTAAGGGGGAGAAGGAAGACACAGTATTGGATGATATCAACCGAGCACTTGGTTTTGATCTTCCAAGAAACATTGAGCCGATCAAGGCGATGGTCTACCTTGTCATGCAACAGGCATTTCATTGTAACTTGCCAAGGATTCATGGACTAGGCTATGTCGATTTTCTATTGAAAAATCTGAATGATTTCCAAGGCCGTTATTCAGATTCACTGGCTTTCCTCAAGAATCAGCTTCAAGTAATTCAAATGGAATTTGAGAGCTTGCAACCTTTCCTGAAGGTTGTTGCAGAAGAGCCGCACAATAAGCACAAGACACTGAATGAAGATTGTGCTACACAGATAATTAGGAAAGCATATGAGGTGGAATATGTAGTTGATGCTTGTATTAACAAAGAAGCTCCTCATTGGTGCCTCGAGCGTTGGCTCCTGGATATCATAGAGGAGATTACTTGTATCAAAGCAAAGATTCAGGAAAAGAACACAGTTGAGGATACAATGAAGAGTGTATCACAATTGGCAAGGACTCCAAGGATGAATGAAGAGATTGTTGGGTTTGAGGATGTCATAGAAAATTTAAGAAAAAAACTACTGAATGGACCCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTTTAGGTAAGACGACTTTAGCCAACAGACTCTATTCTGACAGGTCAGTTGTTTCTCAATTTGATATTTGTGCACAATGTTGTGTGTCTCAAGTATATTCTTACAAGGACTTGTTATTGGCCTTGCTACGTGATGCTATTGGTGAGGAATCTGAGCGTAGAGAACTGCCTGACAATGAATTAGCTGATATGCTTCGCAAAACTTTATTGCCCCAAAGGTACCTTATACTTGTTGATGACGTGTGGGAAAATAGTGTTTGGGATGATTTAAGAGGTTGTTTTCCAGATGCCAATAACAGAAGCAGAATCATTCTAACAACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCATAGTGATCCCCTTCATCTTCGTATGTTTGACGAAGATGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAAGAAAGCTGTTCCCCTCTCCTAAAAAAATTTGGGCTAAAAATAGCAAAAATGTGTGGACAACTCCCTCTTTCAATTGTTTTGGTGGCTGGTATTCTGTCGGAGATGGAAAAGGAAGTAGAATGTTGGGAACAAGTGGCCAACAATTTGGGTACCCACATTCACAATGACTCAAGAGCCATTGTAGACCAAAGTTATCATGTTTTACCCTGTCATCTTAAGTCTTGCTTCCTTTATTTTGGAGCATTTTTGGAGGATGAAGTGATTTATAGTTCAAGGTTAATAAGGTTATGGATATCAGAAGCATTTATAAAAAGTTGTGAAGGCAGGAGGTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTTATTGGAAGAAATCTAGTAATGGTTACTCAGAGGGCCGATTCAGATGGTAAGATCAAAGCATGTCGCCTTCATGATGTATTACTCGATTTCTGCAAGAAAAGAGCAGCTGAGGAGAATTTTCTACTATGGATAAATAGGGATCAGATCAGTACCAAAGCTGTTTACTCTCACAAGCAGCATGCTCACTTGGCCTTCACTGAAATGGATAATCTTGTTGAATGGAGTGCGTCTTGTTCACTTGTTGGCTCTGTACTTTTTAAGAATCCTGACTCATACTCTCCTGCTTTTTCAATTTCACCCATTTTATTAAATTTTAAGTTTCTAAAAGTATTGGATTTGGAGCACCGGGTTGTTATTGATTTTATTCCAACTGAGCTCTTTTATTTGAGGTATTTATCTGCATCCATTGATCAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAAGAGTACACCAGTTGGGAGACATAACACGCTATTACTACCTAGTACAATTTGGGATATGGTTAAATTGAGACATCTGCATATTCCTATATTCCGTCCAGAAAATGAAGAAGCATTACTTGAGAACTCTGCAAGACTTTATGATTTGGAAACCATTTCCACTCCATATTTCTCTAGTGTTGAGGATGCAGAATTGATTCTGAGAAAAATACCTAATCTTCGAAAACTGATATGTGAAGTTGAATGTTTAGAATACCCTCCTCAGTACCATGTGTTAAATTTTCCAATACGGCTTGAAATACTAAAGCTTTATCGATCAAAAGCCTTTAAAACCATCTCCTTTTGCATCTCTGCACCAAATCTCAAATACCTAGAACTCTCTGGCTTTTACATGGATTCTCAATACTTATCAGAAACTGCTGATCATCTCAAGCACCTTGAGGTACTCAAACTGTACTACTTTGCATTTGGTGATCATATGGAATGGAAAGTGAGCAATGGCATGTTCCCTCAACTCAAAATCTTGAAACTAAAATGTGTGTCCTTGAAGAAATGGATTGTAGCTGATGATGCCTTTCCTAACCTTGAACAATTGGTTTTGTGTGGATGTCAAGATCTTAAGGAGATCCCTTCTTGTTTGATGGACATCCTTTCTCTCAAGTACATCGAGGTAGAAAACTGCAATGAGTCGGTTGTCAAGTCAGCCATGAATATACAAGAAACACAAGTCGAAGATTATCAAAATACTAATTTCAAGCTCGTTCTCATCAAGATTCATCTTTTTTGTCTTTTCGATATGAAAGGGATAGAATCAGTTTCATCTGATGAGAAAGAGAAGAAACTTACTGTGACCGGAGATGTGGATGCTGATGAAGGTCAATTAGTTGTGGAGAAACTGAGAAAGCGTGGCATGCCAGGGTTTAAGTTACTTATAAGAATTCAGAACATACGAAAGGTGTACAACTTTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MLYFNNELSALKDHLLRKLQYYTTSYAVRDRINFILWELKFLDCFLYLKRLPFASECGMLNVSQKMLEIWKSRWNKLIYICMYDQEGSPWDAIVYWKELIWHTKQEFRAQYSFPKSPLAANEVIDDDDNTHSPEFVMEVIDVFVGNINVLVKINDPWSCFFVPGLKEQIERVLKELKLLRFFVCFVSNKCIEPQYRCTTFYTHALIEASYIAMVVWLHLPIYGSRNQDLAPSEVSRLLSDFMEMKIKSIEPGISRNSIYIDVLQALKSTIPQAQKKHVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGEKEDTVLDDINRALGFDLPRNIEPIKAMVYLVMQQAFHCNLPRIHGLGYVDFLLKNLNDFQGRYSDSLAFLKNQLQVIQMEFESLQPFLKVVAEEPHNKHKTLNEDCATQIIRKAYEVEYVVDACINKEAPHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKSVSQLARTPRMNEEIVGFEDVIENLRKKLLNGPKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLALLRDAIGEESERRELPDNELADMLRKTLLPQRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEESCSPLLKKFGLKIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGTHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDEVIYSSRLIRLWISEAFIKSCEGRRLEDIAEGYLENLIGRNLVMVTQRADSDGKIKACRLHDVLLDFCKKRAAEENFLLWINRDQISTKAVYSHKQHAHLAFTEMDNLVEWSASCSLVGSVLFKNPDSYSPAFSISPILLNFKFLKVLDLEHRVVIDFIPTELFYLRYLSASIDQNSIPSSISNLWNLETLILKSTPVGRHNTLLLPSTIWDMVKLRHLHIPIFRPENEEALLENSARLYDLETISTPYFSSVEDAELILRKIPNLRKLICEVECLEYPPQYHVLNFPIRLEILKLYRSKAFKTISFCISAPNLKYLELSGFYMDSQYLSETADHLKHLEVLKLYYFAFGDHMEWKVSNGMFPQLKILKLKCVSLKKWIVADDAFPNLEQLVLCGCQDLKEIPSCLMDILSLKYIEVENCNESVVKSAMNIQETQVEDYQNTNFKLVLIKIHLFCLFDMKGIESVSSDEKEKKLTVTGDVDADEGQLVVEKLRKRGMPGFKLLIRIQNIRKVYNF

Domains

Domain Start-End Description Sequence

HMMPfam: PF12061
IPR021929
96-496 DUF3542
Late blight resistance protein R1

WKELIWHTKQEFRAQYSFPKSPLAANEVIDDDDNTHSPEFVMEVIDVFVGNINVLVKINDPWSCFFVPGLKEQIERVLKELKLLRFFVCFVSNKCIEPQYRCTTFYTHALIEASYIAMVVWLHLPIYGSRNQDLAPSEVSRLLSDFMEMKIKSIEPGISRNSIYIDVLQALKSTIPQAQKKHVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGEKEDTVLDDINRALGFDLPRNIEPIKAMVYLVMQQAFHCNLPRIHGLGYVDFLLKNLNDFQGRYSDSLAFLKNQLQVIQMEFESLQPFLKVVAEEPHNKHKTLNEDCATQIIRKAYEVEYVVDACINKEAPHWCLERWLLDIIEEITCIKAKIQE

HMMPanther: PTHR11017
369-862 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVYLVMQQAFHCNLPRIHGLGYVDFLLKNLNDFQGRYSDSLAFLKNQLQVIQMEFESLQPFLKVVAEEPHNKHKTLNEDCATQIIRKAYEVEYVVDACINKEAPHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKSVSQLARTPRMNEEIVGFEDVIENLRKKLLNGPKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLALLRDAIGEESERRELPDNELADMLRKTLLPQRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEESCSPLLKKFGLKIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGTHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDEVIYSSRLIRLWISEAFIKSCEGRRLEDIAEGYLENLIGRNLVMVTQRADSDGKIKACRLHDVLLDFCKKRAAEENFLLWINR

HMMPanther: PTHR11017:SF126
369-862 PTHR11017:SF126,OS11G0237600 PROTEIN

MVYLVMQQAFHCNLPRIHGLGYVDFLLKNLNDFQGRYSDSLAFLKNQLQVIQMEFESLQPFLKVVAEEPHNKHKTLNEDCATQIIRKAYEVEYVVDACINKEAPHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKSVSQLARTPRMNEEIVGFEDVIENLRKKLLNGPKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLALLRDAIGEESERRELPDNELADMLRKTLLPQRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEESCSPLLKKFGLKIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGTHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDEVIYSSRLIRLWISEAFIKSCEGRRLEDIAEGYLENLIGRNLVMVTQRADSDGKIKACRLHDVLLDFCKKRAAEENFLLWINR

superfamily: SSF52540
502-750 SSF52540

DTMKSVSQLARTPRMNEEIVGFEDVIENLRKKLLNGPKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLALLRDAIGEESERRELPDNELADMLRKTLLPQRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEESCSPLLKKFGLKIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGTHIHND

Gene3D: G3DSA:3.40.50.300
514-662 G3DSA:3.40.50.300

PRMNEEIVGFEDVIENLRKKLLNGPKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLALLRDAIGEESERRELPDNELADMLRKTLLPQRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEV

HMMPfam: PF00931
IPR002182
524-799 NB-ARC,NBS
NB-ARC

EDVIENLRKKLLNGPKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLALLRDAIGEESERRELPDNELADMLRKTLLPQRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEESCSPLLKKFGLKIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANNLGTHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDEVIYSSRLIRLWISEAFIKS

FPrintScan: PR00364
IPR000767
543-558 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
618-632 DISEASERSIST
Disease resistance protein

TLLPQRYLILVDDVW

FPrintScan: PR00364
IPR000767
712-726 DISEASERSIST
Disease resistance protein

CGQLPLSIVLVAGIL

superfamily: SSF52047
913-1200 SSF52047,LRR

SISPILLNFKFLKVLDLEHRVVIDFIPTELFYLRYLSASIDQNSIPSSISNLWNLETLILKSTPVGRHNTLLLPSTIWDMVKLRHLHIPIFRPENEEALLENSARLYDLETISTPYFSSVEDAELILRKIPNLRKLICEVECLEYPPQYHVLNFPIRLEILKLYRSKAFKTISFCISAPNLKYLELSGFYMDSQYLSETADHLKHLEVLKLYYFAFGDHMEWKVSNGMFPQLKILKLKCVSLKKWIVADDAFPNLEQLVLCGCQDLKEIPSCLMDILSLKYIEVENCN

Gene3D: G3DSA:3.80.10.10
915-1043 G3DSA:3.80.10.10

SPILLNFKFLKVLDLEHRVVIDFIPTELFYLRYLSASIDQNSIPSSISNLWNLETLILKSTPVGRHNTLLLPSTIWDMVKLRHLHIPIFRPENEEALLENSARLYDLETISTPYFSSVEDAELILRKIP

FPrintScan: PR00364
IPR000767
919-935 DISEASERSIST
Disease resistance protein

LNFKFLKVLDLEHRVVI

Gene3D: G3DSA:3.80.10.10
1044-1200 G3DSA:3.80.10.10

NLRKLICEVECLEYPPQYHVLNFPIRLEILKLYRSKAFKTISFCISAPNLKYLELSGFYMDSQYLSETADHLKHLEVLKLYYFAFGDHMEWKVSNGMFPQLKILKLKCVSLKKWIVADDAFPNLEQLVLCGCQDLKEIPSCLMDILSLKYIEVENCN


List of References

Agim Ballvora, Anika Jöcker, Prisca Viehöver, Hirofumi Ishihara, Jürgen Paal, Khalid Meksem, Rémy Bruggmann, Heiko Schoof, Bernd Weisshaar, Christiane Gebhardt
Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
BMC Genomics: 2007, 8();112
PubMed:17474978 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox