PRGDB00048336 (F-box protein)

From PRG Wiki
Jump to: navigation, search
F-box protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942393 (EF514212)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig R1, complete sequence.

DNA Sequence

ATGTTTTCCGGCGAATATTTGTCTTCAAAAAAACGTCACCCGCTCGATTTTTTGCAGCGAATTGAAGACGAATGGGGTAGTTACATGCCGGAGACTATAAAGGAACGAATTTATTTACTCAAAACAGAGTTCAAATTCATGGATATTTTTCTCAGTATTCAGAGCTTCACTGATGAACCAAACATGCTAAATGTCACTCAGAAAGTTCATGCTCTGTTTCAAGATTCCGCATTTGATGTATCAAAAATATATCAAAATCTCAATCGCCTTACTTCCCTGCTGCAGAACAAAATTCAGGTGACTAAGATGGAAATCAGAGCTAATTATTCTTTCTTCCCCGGAATTTCATTGCAATTGCCTTCGCTCGAAAAGAGTGGGGTTGATAATTCCAAGTTTGTAATGAAATTCATCAATGGTGTTGTACAGAATCTTCGCGAGTTAGCAGAGATCGATGATTTCTGTTCTCGCGAAATACAGGAGGTTTTAAAAGAGCTGAAGTTGTTGAAGAGTCTTGTAGGCTTTTTATCAAACAGGTGGTGTGCAGAGCCTCAGAGCGTACGTACTTTCTTCGGTCATGTTCTATTTGTGGCTGGGTTTGCAGCAATGGTTGTCTGGTTGTACATGCCCAGCTATGACAATAACAGAGATCAGGATTTGGTTCCTGGTGAGATGAATTTCTTGCTTTCTTATCTCGTGCGGATGAGGATTAAGCCTGTTATTCCGTGCATCCGCAAAATGTATGTTGATGTACTACAAGCTTTGAAATGGACAATGCAATCAGATTTGTCTCTGAATATCCAAAATGTGTATGTAGCTGAGATTGAAGCTGGCTTTGTGGAGACTCTCATACACAACATGGAGGAGATACGGAGTATTAGTACTCTTAGTCGGATAGAGTTTTTGAATCATCAAATGGCAACCCTTGTAGAGATGCTCAAATTCTTGAGAGCCAATCTGATCCATTTGCCAATATTGGGTCTTGAATTTCATCTTCAAGATATTGATACTGTCATCATTGATGTGGGACTTCTCGTTTACTCGTTATACGATTGTGAGGAGCAGGAGGAAGTGAACCAAAGACTATTTATTGATTTGCCCAAAAGCATTCAGCATATCAATGAAGTGATCTTCCTCGTGAGTCGAAAGGCATTTCAATATAATTTGCCTAAGGTCCATGGACTAGGTTGTGTTGATTTCCTTCTGAACAACTTGAAGGAGTTCCAAGACCGTTATTCAGATTCACATTATTCTTTTGTTAAGAGCCAACTTCAAGTTATTCAGAAGGAACTTGAGGGCTTACAACCTTTTCTCAAGGATGTGGCGGAAGAGTGCTACAATAAGCATGAAAGGCTCCAACATTGTGCTGCACTATTAAATGGCAAAGCTTATGAGGTGGAATATATAGTTGATGCTTCTGTTAGAAAAGGAGTTCCTGAATGGTGTCTTGTTCGTTGGCTCTTCGACATCATAAAGGAAGTTATACTTATCAAGGAAGAGGTCACAAAGATTCAGGAAAAGGAACTTTTTAAGTTTGACTTTGTATTACATGATACCTTGGATACCACCCCTGCTCATATATCATCAGAATCGACTAACACTCCAAGGATGACCGATGAAGAAGTTGTCGGTTTTGAAGATGTTATGGAAAAACTAAGAGATCAACTAATAAGAGGAACCAAACAGCTAGATGTTATCTCAGTTGTTGGAATGCCTGGATTAGGCAAGACAACTGTGGCCAACAAACTTTATTCTGACAAGTTAGTTGTCTCTCGATTTGATATCTGTGCAAAATGTTGTGTATCCCAAGCATATTCGCGTAGGAGTGTGTTACTTTCCATTCTACGTGATGCCATTGGTGAGTCTCCTACTCTTACTAAATTGTCTACGGATGTATTAGTAGATCAGCTTCGCAAAACTTTATTGTGGAAAAGATATCTTATCCTTGTTGATGACATATGGGAAGCTAGTGTTTGGGATGATTTAAGATGTTGTTTCCATGATTCCAATAATGGAAGTAGAATTATCCTAACAACACAACATGCTGATGTTGCTGAAAATGCTAAATCTGTTAGTGATCCACTTCATCTTCGTATTCTTAATGATGATGAAAGTTGGAAGTTACTAAAACAGAAAGTGTTTGGTGAAGAAAGCTACTCCGTGCTCCTTTCAAATGTTGGGCAAGAAATAGCAAACAAGTGTAGGGGACTGCCTCTTTCAATTGTTTTGGTGGCTGGTATGCTAACAAAGATGGAGAAGAGTGAACAATGCTGGAAACAAGTGGCTATGAATTTATGTACTAATGTTCTCAGCAACTCAAAGGCCATCATAGAGCAAAGTTATCAGAATTTACCTTATCATCTAAAGCCTTGCTTTCTTTATTTTGGAGTATTTTTGGAGGACAAAGAAATCAACATTTCAATCTTGACATGGTTATGGATTTCAGAAGGATTTATAAAAAGTCGTGATGACAAGAGTCTGGAGGATATAGCAGAAGGCTACTTGGAGAATCTTATTGGAAGAAATCTAGTTATGGTTGCTAAATGGGGTTCCGGCGGTAAGGTCAAAACATGCCGTATTCATGACCTGTTGCTTTATTTCTGTAAGGAAAGAGCCAAGGAGAAGAATCTTCTACTGTGGATGAAACGGGACCAAAATGTCAATACGTCTTCCTCTATTTACTCTCACAAGCAGCTTGTTCAACGTCGCATGCCCATCAATTCTCAAGTGATTGATCTTGTGAAATGGAGCTCACTTGTTGGCACTGTACATTGCAGGGAAGATAGAAATAAAGGTTCCTTTTCAATTGTCCAATTCTCTCACATTTACTTCAGATTTCTAAAAGTGTTGAATTTGGAGCTCATTGTAATTGATTCTTTCCCAACTGAGCTAGTTTACTTGAGGTATTTTGCTGCACGAACTTCTCAGAAGTCAATCACATCGTCCACAGTCAATCTTCGAAACCTTGAAACTTTGATAGTCAAACCGATGGGAGGAAAATTGATATTGCCACTTACACTTTTGAACATGGTTAAACTGAGACATCTGCAGATATATAGCAAAGCTCATTTTTCCACTTTAAATGCTGCAGAAGAATTGCTTGAGAACTCAAAATTCAACAATTTGATAACTCTTTCCTCTCCAACTTTTTGTTGTGTGAGGGATGCAGAATTGATGTTGAGAACACCTAACCTTCGAAAACTGAGATGCTCATTTGTTGGTTGGGGTTATCCTTCTCATGTAATGAGCTCCCTAACACGGCTTGAGACACTCAGTATTAAAATGGATTCTTGCGGAAGTACTCAAGCTGGTAGCAGTATTTTTCTCAAAGGCCGAATGGGAAGGACGAGTGACAAGTTCCATCAACTCAAAGTTTTGAAAGTAGTTGATTGTCCTTGTTTTAAAAAATGGAGCGTCTCTGACGATGCTTTTCCTTGCCTTGAACACTTGGTATTGAGAAGATGTCGATATCTTGAGGCAATCCCCTCTCGCTTTGGAGACATCACATCTCTAATATCCATTGAGGTAAAGTCATGCAAAGAATCGCTTGTCGAGTCAGCCATGGTCATCAGGGAATCACAAGTTGAAGAGATGCAGAATTATGATTTCAAGGTCTTCATCCACAAGTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MFSGEYLSSKKRHPLDFLQRIEDEWGSYMPETIKERIYLLKTEFKFMDIFLSIQSFTDEPNMLNVTQKVHALFQDSAFDVSKIYQNLNRLTSLLQNKIQVTKMEIRANYSFFPGISLQLPSLEKSGVDNSKFVMKFINGVVQNLRELAEIDDFCSREIQEVLKELKLLKSLVGFLSNRWCAEPQSVRTFFGHVLFVAGFAAMVVWLYMPSYDNNRDQDLVPGEMNFLLSYLVRMRIKPVIPCIRKMYVDVLQALKWTMQSDLSLNIQNVYVAEIEAGFVETLIHNMEEIRSISTLSRIEFLNHQMATLVEMLKFLRANLIHLPILGLEFHLQDIDTVIIDVGLLVYSLYDCEEQEEVNQRLFIDLPKSIQHINEVIFLVSRKAFQYNLPKVHGLGCVDFLLNNLKEFQDRYSDSHYSFVKSQLQVIQKELEGLQPFLKDVAEECYNKHERLQHCAALLNGKAYEVEYIVDASVRKGVPEWCLVRWLFDIIKEVILIKEEVTKIQEKELFKFDFVLHDTLDTTPAHISSESTNTPRMTDEEVVGFEDVMEKLRDQLIRGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRSVLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRYLILVDDIWEASVWDDLRCCFHDSNNGSRIILTTQHADVAENAKSVSDPLHLRILNDDESWKLLKQKVFGEESYSVLLSNVGQEIANKCRGLPLSIVLVAGMLTKMEKSEQCWKQVAMNLCTNVLSNSKAIIEQSYQNLPYHLKPCFLYFGVFLEDKEINISILTWLWISEGFIKSRDDKSLEDIAEGYLENLIGRNLVMVAKWGSGGKVKTCRIHDLLLYFCKERAKEKNLLLWMKRDQNVNTSSSIYSHKQLVQRRMPINSQVIDLVKWSSLVGTVHCREDRNKGSFSIVQFSHIYFRFLKVLNLELIVIDSFPTELVYLRYFAARTSQKSITSSTVNLRNLETLIVKPMGGKLILPLTLLNMVKLRHLQIYSKAHFSTLNAAEELLENSKFNNLITLSSPTFCCVRDAELMLRTPNLRKLRCSFVGWGYPSHVMSSLTRLETLSIKMDSCGSTQAGSSIFLKGRMGRTSDKFHQLKVLKVVDCPCFKKWSVSDDAFPCLEHLVLRRCRYLEAIPSRFGDITSLISIEVKSCKESLVESAMVIRESQVEEMQNYDFKVFIHK

Domains

Domain Start-End Description Sequence

HMMPfam: PF12061
IPR021929
94-502 DUF3542
Late blight resistance protein R1

LQNKIQVTKMEIRANYSFFPGISLQLPSLEKSGVDNSKFVMKFINGVVQNLRELAEIDDFCSREIQEVLKELKLLKSLVGFLSNRWCAEPQSVRTFFGHVLFVAGFAAMVVWLYMPSYDNNRDQDLVPGEMNFLLSYLVRMRIKPVIPCIRKMYVDVLQALKWTMQSDLSLNIQNVYVAEIEAGFVETLIHNMEEIRSISTLSRIEFLNHQMATLVEMLKFLRANLIHLPILGLEFHLQDIDTVIIDVGLLVYSLYDCEEQEEVNQRLFIDLPKSIQHINEVIFLVSRKAFQYNLPKVHGLGCVDFLLNNLKEFQDRYSDSHYSFVKSQLQVIQKELEGLQPFLKDVAEECYNKHERLQHCAALLNGKAYEVEYIVDASVRKGVPEWCLVRWLFDIIKEVILIKEEVTK

HMMPanther: PTHR11017:SF126
390-880 PTHR11017:SF126,OS11G0237600 PROTEIN

KVHGLGCVDFLLNNLKEFQDRYSDSHYSFVKSQLQVIQKELEGLQPFLKDVAEECYNKHERLQHCAALLNGKAYEVEYIVDASVRKGVPEWCLVRWLFDIIKEVILIKEEVTKIQEKELFKFDFVLHDTLDTTPAHISSESTNTPRMTDEEVVGFEDVMEKLRDQLIRGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRSVLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRYLILVDDIWEASVWDDLRCCFHDSNNGSRIILTTQHADVAENAKSVSDPLHLRILNDDESWKLLKQKVFGEESYSVLLSNVGQEIANKCRGLPLSIVLVAGMLTKMEKSEQCWKQVAMNLCTNVLSNSKAIIEQSYQNLPYHLKPCFLYFGVFLEDKEINISILTWLWISEGFIKSRDDKSLEDIAEGYLENLIGRNLVMVAKWGSGGKVKTCRIHDLLLYFCKERAKEKNLLLWM

HMMPanther: PTHR11017
390-880 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KVHGLGCVDFLLNNLKEFQDRYSDSHYSFVKSQLQVIQKELEGLQPFLKDVAEECYNKHERLQHCAALLNGKAYEVEYIVDASVRKGVPEWCLVRWLFDIIKEVILIKEEVTKIQEKELFKFDFVLHDTLDTTPAHISSESTNTPRMTDEEVVGFEDVMEKLRDQLIRGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRSVLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRYLILVDDIWEASVWDDLRCCFHDSNNGSRIILTTQHADVAENAKSVSDPLHLRILNDDESWKLLKQKVFGEESYSVLLSNVGQEIANKCRGLPLSIVLVAGMLTKMEKSEQCWKQVAMNLCTNVLSNSKAIIEQSYQNLPYHLKPCFLYFGVFLEDKEINISILTWLWISEGFIKSRDDKSLEDIAEGYLENLIGRNLVMVAKWGSGGKVKTCRIHDLLLYFCKERAKEKNLLLWM

superfamily: SSF52540
524-771 SSF52540

AHISSESTNTPRMTDEEVVGFEDVMEKLRDQLIRGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRSVLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRYLILVDDIWEASVWDDLRCCFHDSNNGSRIILTTQHADVAENAKSVSDPLHLRILNDDESWKLLKQKVFGEESYSVLLSNVGQEIANKCRGLPLSIVLVAGMLTKMEKSEQCWKQVAMNLCTNVLSN

Gene3D: G3DSA:3.40.50.300
544-687 G3DSA:3.40.50.300

FEDVMEKLRDQLIRGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRSVLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRYLILVDDIWEASVWDDLRCCFHDSNNGSRIILTTQHADVAENA

HMMPfam: PF00931
IPR002182
545-822 NB-ARC,NBS
NB-ARC

EDVMEKLRDQLIRGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRSVLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRYLILVDDIWEASVWDDLRCCFHDSNNGSRIILTTQHADVAENAKSVSDPLHLRILNDDESWKLLKQKVFGEESYSVLLSNVGQEIANKCRGLPLSIVLVAGMLTKMEKSEQCWKQVAMNLCTNVLSNSKAIIEQSYQNLPYHLKPCFLYFGVFLEDKEINISILTWLWISEGFIKSRD

FPrintScan: PR00364
IPR000767
564-579 DISEASERSIST
Disease resistance protein

VISVVGMPGLGKTTVA

FPrintScan: PR00364
IPR000767
639-653 DISEASERSIST
Disease resistance protein

TLLWKRYLILVDDIW

Gene3D: G3DSA:3.80.10.10
701-710 G3DSA:3.80.10.10

DDESWKLLKQ

FPrintScan: PR00364
IPR000767
733-747 DISEASERSIST
Disease resistance protein

CRGLPLSIVLVAGML

superfamily: SSF52047
942-1179 SSF52047,LRR

YFRFLKVLNLELIVIDSFPTELVYLRYFAARTSQKSITSSTVNLRNLETLIVKPMGGKLILPLTLLNMVKLRHLQIYSKAHFSTLNAAEELLENSKFNNLITLSSPTFCCVRDAELMLRTPNLRKLRCSFVGWGYPSHVMSSLTRLETLSIKMDSCGSTQAGSSIFLKGRMGRTSDKFHQLKVLKVVDCPCFKKWSVSDDAFPCLEHLVLRRCRYLEAIPSRFGDITSLISIEVKSCK

Gene3D: G3DSA:3.80.10.10
961-1179 G3DSA:3.80.10.10

TELVYLRYFAARTSQKSITSSTVNLRNLETLIVKPMGGKLILPLTLLNMVKLRHLQIYSKAHFSTLNAAEELLENSKFNNLITLSSPTFCCVRDAELMLRTPNLRKLRCSFVGWGYPSHVMSSLTRLETLSIKMDSCGSTQAGSSIFLKGRMGRTSDKFHQLKVLKVVDCPCFKKWSVSDDAFPCLEHLVLRRCRYLEAIPSRFGDITSLISIEVKSCK

FPrintScan: PR00364
IPR000767
1165-1181 DISEASERSIST
Disease resistance protein

GDITSLISIEVKSCKES


List of References

Agim Ballvora, Anika Jöcker, Prisca Viehöver, Hirofumi Ishihara, Jürgen Paal, Khalid Meksem, Rémy Bruggmann, Heiko Schoof, Bernd Weisshaar, Christiane Gebhardt
Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
BMC Genomics: 2007, 8();112
PubMed:17474978 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox