PRGDB00048337 (F-box protein)

From PRG Wiki
Jump to: navigation, search
F-box protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942393 (EF514212)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig R1, complete sequence.

DNA Sequence

GGATAGAATCAGTTTCATCTGATGAGAAAGAGAAGAAACTTACTGTGACCGGAGATGTGGATGCTGATGAAGTTCAATTAGTTGTGGAGAAACTGAGAAAGTGTGGCATGCCAGGGTTGTAGTGGCCTAAATTTTACAAACTGTTTTCTCAGTTATCTTTACCTCGTGGCCTCGTTTTACATTTGGGGATCAGATTACCAAACCTTCTTCCTGTGTTTACTCTCACAAGCAGCATGCTCACTTGGCCTTCACTGAAATGCATAATCTTGTAGAATGGAGTGCGTCTTGCTCATTTGTTGGCTCGGTAGTACTTTCCAATAAATATGAGCCATACTTTCATGACTTGTCCTCACTACATGATTTTTCAATTTCACGCATTTTACCAAATTTCAAGTTTCTAAAAGTGTTAGATTTGGAACACCGGGTTTTTATTGATTTTATTCCAACTGAGCTCCCTTACTTGAGGTATTTCTCTGCGCTCATTGATCAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAACCGTAGATCAGCTGACAGCCATAACAGGGTATTACTACCTAGTACAGTTTGGGATATGGTTAAATTGAGACATCTGCATATTCCTAACTTCAGCCCAGAAAATAAAAAAGCATTACTCAAGAACTCTCCAAATCTTGATGATTTGGAAACCCTTTCCTATCCATATTTCGCTCGTGTTAAGGATGCAGAATTGATGCTGAGAAAAACACCTAATCTTCGAAAACTGACATGTAAAGTCAAGTGCTTAGAATACCTCCATCAGTACCATGCATTGAATTTTCCAATTCGGCTTGAAATACTAAAGCTTTATCGATCAAATGCCTTTAAAGCCATCCCCTTTTGCATCTCTGCACCAAATCTCAAATACCTGAAACTCTCTGGCTTTTACCTGGATTCTCAGTACTTATCAAAAACTGCTGATCATCTGAAGAACCTTGAGGTACTCAAACTGTACTACGTTGAATTTGGTGATCATAGGGAATGGAAAGTGAGCAATGGCATGTTCCCTCAACTCAAAATCTTGAAACTAGAGGATGTGTCCTTGATGAAATGGATTGTAGCTGATGATGCCTTTCCTAACCTTGAACAATTAGTTTTGCGTGGATGTCAAGATCTTATGGAGATCCCTTCTTGTTTCATGGACATCCTTTCCCTGCAGTACATCGAGGTAGAAGACTGCAATGAGTCGGTTGTCAAGTCAGCCATGAATATACAAGAAACACAAGTCGAAGATTATCAAAATACTAATTTCAAACTCGTTCTCATCGAGATGTATTTCAACAATGAATTGTCTGATCTGAAAGATCATCTCCTTAGAAAGCTGCAATATTACACTTACTCGGATGTTGTAAGGGATCGAATAAATTTCATTCTATGGGAGTTTAAATTCCTTGATTGTTTTCTCTATTTGAAAAGCTTCCCTTTTGCAAGTGAATGTGGTATGCTACATGTCTCACAGAAAATGATAGAAATTTGGAAAAGTCAGTGGAACAAGTTAATTTATATATGTATGTACGATGAAGAAGGTAGTCCTTGGGATGCAGTTGTCTACTGGAAGGAGTTAATTTCGCAGACTAAGCAAGAATTCAGAGCCCAATACTCCTTTCCGAAATCACCACTTGCAGCCAACGAGGTGATTGATGATGATGATGATGATAATACTCATAGCCCCGAATTTGTGATGGAAGTCATCGGTTTTTTCGTGGGGAACATCAATGTTCTAGTGAAGATCAATGATCCATGTTCGTGCTTTTTTGTTCCAGGACTCAAGGAACAAATAGAACAAATTTTAAAGGAGTTGAAGTTATTGAGATTTTTTGTCTGCTTTGTTTCAAACAAATGTATAGTGCCTCAATACCGATGTACTACTTTTTATACTCGTGCTTTAATTGAGGCTAGCTATATCGCAATGGTTGCGTGGTTGTATTTGCCAATCTATGGCAACGGAAATCAAGACTTGGCTCCAAGTGAAGTCAGTCGTTTGCTTTCTGATTTCATGGAAATGAAAATTAAATCCATTGAGCCAGGCATCAGCCGCAACAGTATTTATATTGATGTCCTGCAAGCTTTGAAGTCCACCATACCACAAGCTCAAAAGAAGCATGTGGAGATTCCAACACACAGTCTGACGGTTGGTTTGAGTGATCAAATGGCTAACCTTCAGGAGATGCTCTGCCTTCTAAGAGACAATCTCATTCATCTGCCAATACTAGATCTGGAATTTCATCTTCAAGATATGGATTCTGTTATTGTTGATGCCGGACTTCTTATTTACTCATTATATGATATCAAGGGGCAGATGGAAGACACATCATTGGACGTTATCAACTGGGCACTTGGTTTTGATCTTCCGAGAAACATTGAGCCTATTAAGGTGATGGCCTATCTTGTCATGCAAAAGGCATTTCATTGTAACTTGCCAAGGATTCATGGACTAGGCTATGTCGATTTTCTATTGAAAAATCTGAATGATTTCCAAGACTGTTATTCAGATTCACTGGCTTTCCTCAAGAATCAACTTCAAGTAATTCAAACGGAATTTGAGAGCTTGCAACCTTTCCTGAAGGTTGTCGCAGAAGAGCCGCACAATAAGCTCAAAACACTGAATGAAGATTGTGCTACACAGATAATTAGGAAAGCATATGAGGTGGAATATGTAGTTGATGCTTGTATTAACAAAGAAGCTCTTCATTGGTGCCTCGAGCGTTGGCTCCTGGATATCATAGAGGAGATTACTTGTATCAAAGCAAAGATTCAGGAAAAGAACACAGTTGAGGATACAATGAAGACTGTCATTGCTCGTACATCATCAAAACTGGCAAGGACTCCGAGGATGAAAGAAGAAATTGTTGGGTTTGAGGATGTCATAGAAAATTTAAGAAAAAAACTACTGAGTAGAACCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTCTAGGTAAGACGACTTTAGCCAACAGACTCTATTCTGACAGGTCAGTTGTCTCTCAATTTGATTTTTGTGCACAATGTTGTGTGTCTCAAGTATATTCGTGTAAGGACTTGTTATTGTCCTTGCTACGTGATGCTATTGGTGAGGAATCTGAGCGTAGAGAACTGCCTGACAATGAATTAGCTGATATGCTTCGGAAAACTTTATTGCCCCGAAGGTACCTTATCCTTGTTGATGACGTGTGGGACAATAGTGCTTGGGATGATTTAAGAGGTTGTTTTCCAGATGTCAATAACAGAAGCAGAATCATTCTAACGACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCGTAGTGATCCCCTTCATCTTCGTATGTTTGACGAAGTTGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAACAGAGCTGTCCCCCTCTCCTAAAAAATATTGGGCTAAGAATAGCAAAAATGTGTGGACAACTACCTCTTTCAATTGTTTTAGTGGCTGGTATTCTGTCAGAGATGGAAAAGGATGTAGAATGTTGGGAACAAGTGGCCAACAATTTGGGTTCCCACATTCACAATGACTCAAGAGCCATTGTAGACCAAAGCTATCATGTTTTACCCTGTCATCTTAAGTCTTGCTTCCTTTATTTTGGAGCATTTTTAGAGGATAGAGTGATTGACATTTCAAGGTTAATAAGGTTATGGATATCAGAAGCATTTATAAAAAGTAGTGAAGGCAGGAGCTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTTATTGGAAGAAATCTAGTAATGGTTACTCAGAGGGCCATTTCAGATGGTAAGGTCAAAGCATGTCGCCTTCATGATGTATTACTCGACTTCTGCAAGGAAAGAGCAGCTGAGGAGAATTTTCTACTATGGATAAATAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MYFNNELSDLKDHLLRKLQYYTYSDVVRDRINFILWEFKFLDCFLYLKSFPFASECGMLHVSQKMIEIWKSQWNKLIYICMYDEEGSPWDAVVYWKELISQTKQEFRAQYSFPKSPLAANEVIDDDDDDNTHSPEFVMEVIGFFVGNINVLVKINDPCSCFFVPGLKEQIEQILKELKLLRFFVCFVSNKCIVPQYRCTTFYTRALIEASYIAMVAWLYLPIYGNGNQDLAPSEVSRLLSDFMEMKIKSIEPGISRNSIYIDVLQALKSTIPQAQKKHVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGQMEDTSLDVINWALGFDLPRNIEPIKVMAYLVMQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVIQTEFESLQPFLKVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHKQHAHLAFTEMHNLVEWSASCSFVGSVVLSNKYEPYFHDLSSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELPYLRYFSALIDQNSIPSSISNLWNLETLILNRRSADSHNRVLLPSTVWDMVKLRHLHIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCKVKCLEYLHQYHALNFPIRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKSAMNIQETQVEDYQNTNFKLVLIEWPKFYKLFSQLSLPRGLVLHLGIESVSSDEKEKKLTVTGDVDADEVQLVVEKLRKCGMPGL

Domains

Domain Start-End Description Sequence

HMMPfam: PF12061
IPR021929
95-497 DUF3542
Late blight resistance protein R1

WKELISQTKQEFRAQYSFPKSPLAANEVIDDDDDDNTHSPEFVMEVIGFFVGNINVLVKINDPCSCFFVPGLKEQIEQILKELKLLRFFVCFVSNKCIVPQYRCTTFYTRALIEASYIAMVAWLYLPIYGNGNQDLAPSEVSRLLSDFMEMKIKSIEPGISRNSIYIDVLQALKSTIPQAQKKHVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGQMEDTSLDVINWALGFDLPRNIEPIKVMAYLVMQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVIQTEFESLQPFLKVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQE

HMMPanther: PTHR11017
375-868 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVIQTEFESLQPFLKVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLHDVLLDFCKERAAEENFLLWINR

HMMPanther: PTHR11017:SF126
375-868 PTHR11017:SF126,OS11G0237600 PROTEIN

MQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVIQTEFESLQPFLKVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLHDVLLDFCKERAAEENFLLWINR

superfamily: SSF52540
508-756 SSF52540

VIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHND

Gene3D: G3DSA:3.40.50.300
520-676 G3DSA:3.40.50.300

PRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRS

HMMPfam: PF00931
IPR002182
530-807 NB-ARC,NBS
NB-ARC

EDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSE

FPrintScan: PR00364
IPR000767
549-564 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
624-638 DISEASERSIST
Disease resistance protein

TLLPRRYLILVDDVW

FPrintScan: PR00364
IPR000767
718-732 DISEASERSIST
Disease resistance protein

CGQLPLSIVLVAGIL

superfamily: SSF52058
844-1259 SSF52058,LRR

RLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHKQHAHLAFTEMHNLVEWSASCSFVGSVVLSNKYEPYFHDLSSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELPYLRYFSALIDQNSIPSSISNLWNLETLILNRRSADSHNRVLLPSTVWDMVKLRHLHIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCKVKCLEYLHQYHALNFPIRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKSAMNIQETQVEDYQNTNFKLVLIEWPKFYKLFSQLSLPR

Gene3D: G3DSA:3.80.10.10
922-1066 G3DSA:3.80.10.10

SSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELPYLRYFSALIDQNSIPSSISNLWNLETLILNRRSADSHNRVLLPSTVWDMVKLRHLHIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCK

Gene3D: G3DSA:3.80.10.10
1084-1215 G3DSA:3.80.10.10

RLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCN

FPrintScan: PR00364
IPR000767
1177-1193 DISEASERSIST
Disease resistance protein

DAFPNLEQLVLRGCQDL


List of References

Agim Ballvora, Anika Jöcker, Prisca Viehöver, Hirofumi Ishihara, Jürgen Paal, Khalid Meksem, Rémy Bruggmann, Heiko Schoof, Bernd Weisshaar, Christiane Gebhardt
Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
BMC Genomics: 2007, 8();112
PubMed:17474978 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox