PRGDB00048338 (F-box protein)

From PRG Wiki
Jump to: navigation, search
F-box protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942393 (EF514212)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig R1, complete sequence.

DNA Sequence

ATGTATTTCAACAATGAATTGTCTGATCTGAAAGATCATCTCCTTAGAAAGCTGCAATATTACACTTACTCGGATGTTGTAAGGGATCGAATAAATTTCATTCTATGGGAGTTTAAATTCCTTGATTGTTTTCTCTATTTGAAAAGCTTCCCTTTTGCAAGTGAATGTGGTATGCTACATGTCTCACAGAAAATGATAGAAATTTGGAAAAGTCAGTGGAACAAGTTAATTTATATATGTATGTACGATGAAGAAGGTAGTCCTTGGGATGCAGTTGTCTACTGGAAGGAGTTAATTTCGCAGACTAAGCAAGAATTCAGAGCCCAATACTCCTTTCCGAAATCACCACTTGCAGCCAACGAGGTGATTGATGATGATGATGATGATAATACTCATAGCCCCGAATTTGTGATGGAAGTCATCGGTTTTTTCGTGGGGAACATCAATGTTCTAGTGAAGATCAATGATCCATGTTCGTGCTTTTTTGTTCCAGGACTCAAGGAACAAATAGAACAAATTTTAAAGGAGTTGAAGTTATTGAGATTTTTTGTCTGCTTTGTTTCAAACAAATGTATAGTGCCTCAATACCGATGTACTACTTTTTATACTCGTGCTTTAATTGAGGCTAGCTATATCGCAATGGTTGCGTGGTTGTATTTGCCAATCTATGGCAACGGAAATCAAGACTTGGCTCCAAGTGAAGTCAGTCGTTTGCTTTCTGATTTCATGGAAATGAAAATTAAATCCATTGAGCCAGGCATCAGCCGCAACAGTATTTATATTGATGTCCTGCAAGCTTTGAAGTCCACCATACCACAAGCTCAAAAGAAGCATGTGGAGATTCCAACACACAGTCTGACGGTTGGTTTGAGTGATCAAATGGCTAACCTTCAGGAGATGCTCTGCCTTCTAAGAGACAATCTCATTCATCTGCCAATACTAGATCTGGAATTTCATCTTCAAGATATGGATTCTGTTATTGTTGATGCCGGACTTCTTATTTACTCATTATATGATATCAAGGGGCAGATGGAAGACACATCATTGGACGTTATCAACTGGGCACTTGGTTTTGATCTTCCGAGAAACATTGAGCCTATTAAGGTGATGGCCTATCTTGTCATGCAAAAGGCATTTCATTGTAACTTGCCAAGGATTCATGGACTAGGCTATGTCGATTTTCTATTGAAAAATCTGAATGATTTCCAAGACTGTTATTCAGATTCACTGGCTTTCCTCAAGAATCAACTTCAAGTTGTCGCAGAAGAGCCGCACAATAAGCTCAAAACACTGAATGAAGATTGTGCTACACAGATAATTAGGAAAGCATATGAGGTGGAATATGTAGTTGATGCTTGTATTAACAAAGAAGCTCTTCATTGGTGCCTCGAGCGTTGGCTCCTGGATATCATAGAGGAGATTACTTGTATCAAAGCAAAGATTCAGGAAAAGAACACAGTTGAGGATACAATGAAGACTGTCATTGCTCGTACATCATCAAAACTGGCAAGGACTCCGAGGATGAAAGAAGAAATTGTTGGGTTTGAGGATGTCATAGAAAATTTAAGAAAAAAACTACTGAGTAGAACCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTCTAGGTAAGACGACTTTAGCCAACAGACTCTATTCTGACAGGTCAGTTGTCTCTCAATTTGATTTTTGTGCACAATGTTGTGTGTCTCAAGTATATTCGTGTAAGGACTTGTTATTGTCCTTGCTACGTGATGCTATTGGTGAGGAATCTGAGCGTAGAGAACTGCCTGACAATGAATTAGCTGATATGCTTCGGAAAACTTTATTGCCCCGAAGGTACCTTATCCTTGTTGATGACGTGTGGGACAATAGTGCTTGGGATGATTTAAGAGGTTGTTTTCCAGATGTCAATAACAGAAGCAGAATCATTCTAACGACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCGTAGTGATCCCCTTCATCTTCGTATGTTTGACGAAGTTGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAACAGAGCTGTCCCCCTCTCCTAAAAAATATTGGGCTAAGAATAGCAAAAATGTGTGGACAACTACCTCTTTCAATTGTTTTAGTGGCTGGTATTCTGTCAGAGATGGAAAAGGATGTAGAATGTTGGGAACAAGTGGCCAACAATTTGGGTTCCCACATTCACAATGACTCAAGAGCCATTGTAGACCAAAGCTATCATGTTTTACCCTGTCATCTTAAGTCTTGCTTCCTTTATTTTGGAGCATTTTTAGAGGATAGAGTGATTGACATTTCAAGGTTAATAAGGTTATGGATATCAGAAGCATTTATAAAAAGTAGTGAAGGCAGGAGCTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTTATTGGAAGAAATCTAGTAATGGTTACTCAGAGGGCCATTTCAGATGGTAAGGTCAAAGCATGTCGCCTTCATGATGTATTACTCGACTTCTGCAAGGAAAGAGCAGCTGAGGAGAATTTTCTACTATGGATAAATAGGGATCAGATTACCAAACCTTCTTCCTGTGTTTACTCTCACAAGCAGCATGCTCACTTGGCCTTCACTGAAATGCATAATCTTGTAGAATGGAGTGCGTCTTGCTCATTTGTTGGCTCGGTAGTACTTTCCAATAAATATGAGCCATACTTTCATGACTTGTCCTCACTACATGATTTTTCAATTTCACGCATTTTACCAAATTTCAAGTTTCTAAAAGTGTTAGATTTGGAACACCGGGTTTTTATTGATTTTATTCCAACTGAGCTCCCTTACTTGAGGTATTTCTCTGCGCTCATTGATCAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAACCGTAGATCAGCTGACAGCCATAACAGGGTATTACTACCTAGTACAGTTTGGGATATGGTTAAATTGAGACATCTGCATATTCCTAACTTCAGCCCAGAAAATAAAAAAGCATTACTCAAGAACTCTCCAAATCTTGATGATTTGGAAACCCTTTCCTATCCATATTTCGCTCGTGTTAAGGATGCAGAATTGATGCTGAGAAAAACACCTAATCTTCGAAAACTGACATGTAAAGTCAAGTGCTTAGAATACCTCCATCAGTACCATGCATTGAATTTTCCAATTCGGCTTGAAATACTAAAGCTTTATCGATCAAATGCCTTTAAAGCCATCCCCTTTTGCATCTCTGCACCAAATCTCAAATACCTGAAACTCTCTGGCTTTTACCTGGATTCTCAGTACTTATCAAAAACTGCTGATCATCTGAAGAACCTTGAGGTACTCAAACTGTACTACGTTGAATTTGGTGATCATAGGGAATGGAAAGTGAGCAATGGCATGTTCCCTCAACTCAAAATCTTGAAACTAGAGGATGTGTCCTTGATGAAATGGATTGTAGCTGATGATGCCTTTCCTAACCTTGAACAATTAGTTTTGCGTGGATGTCAAGATCTTATGGAGATCCCTTCTTGTTTCATGGACATCCTTTCCCTGCAGTACATCGAGGTAGAAGACTGCAATGAGTCGGTTGTCAAGTCAGCCATGAATATACAAGAAACACAAGTCGAAGATTATCAAAATACTAATTTCAAACTCGTTCTCATCGAGAAATGGCCTAAATTTTACAAACTGTTTTCTCAGTTATCTTTACCTCGTGGCCTCGTTTTACATTTGGGTTCTTCTCTTAGTTTTCTTTGCAGAAAAAGGCGTTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MYFNNELSDLKDHLLRKLQYYTYSDVVRDRINFILWEFKFLDCFLYLKSFPFASECGMLHVSQKMIEIWKSQWNKLIYICMYDEEGSPWDAVVYWKELISQTKQEFRAQYSFPKSPLAANEVIDDDDDDNTHSPEFVMEVIGFFVGNINVLVKINDPCSCFFVPGLKEQIEQILKELKLLRFFVCFVSNKCIVPQYRCTTFYTRALIEASYIAMVAWLYLPIYGNGNQDLAPSEVSRLLSDFMEMKIKSIEPGISRNSIYIDVLQALKSTIPQAQKKHVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGQMEDTSLDVINWALGFDLPRNIEPIKVMAYLVMQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHKQHAHLAFTEMHNLVEWSASCSFVGSVVLSNKYEPYFHDLSSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELPYLRYFSALIDQNSIPSSISNLWNLETLILNRRSADSHNRVLLPSTVWDMVKLRHLHIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCKVKCLEYLHQYHALNFPIRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKSAMNIQETQVEDYQNTNFKLVLIEKWPKFYKLFSQLSLPRGLVLHLGSSLSFLCRKRR

Domains

Domain Start-End Description Sequence

HMMPfam: PF12061
IPR021929
95-483 DUF3542
Late blight resistance protein R1

WKELISQTKQEFRAQYSFPKSPLAANEVIDDDDDDNTHSPEFVMEVIGFFVGNINVLVKINDPCSCFFVPGLKEQIEQILKELKLLRFFVCFVSNKCIVPQYRCTTFYTRALIEASYIAMVAWLYLPIYGNGNQDLAPSEVSRLLSDFMEMKIKSIEPGISRNSIYIDVLQALKSTIPQAQKKHVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIVDAGLLIYSLYDIKGQMEDTSLDVINWALGFDLPRNIEPIKVMAYLVMQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQE

HMMPanther: PTHR11017
361-854 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PRNIEPIKVMAYLVMQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLHDVLLDFCKERAAEENFLLWINR

HMMPanther: PTHR11017:SF126
361-854 PTHR11017:SF126,OS11G0237600 PROTEIN

PRNIEPIKVMAYLVMQKAFHCNLPRIHGLGYVDFLLKNLNDFQDCYSDSLAFLKNQLQVVAEEPHNKLKTLNEDCATQIIRKAYEVEYVVDACINKEALHWCLERWLLDIIEEITCIKAKIQEKNTVEDTMKTVIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRAISDGKVKACRLHDVLLDFCKERAAEENFLLWINR

superfamily: SSF52540
494-742 SSF52540

VIARTSSKLARTPRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHND

Gene3D: G3DSA:3.40.50.300
506-662 G3DSA:3.40.50.300

PRMKEEIVGFEDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRS

HMMPfam: PF00931
IPR002182
516-793 NB-ARC,NBS
NB-ARC

EDVIENLRKKLLSRTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDFCAQCCVSQVYSCKDLLLSLLRDAIGEESERRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVRSDPLHLRMFDEVESWKLLEKKVFGEQSCPPLLKNIGLRIAKMCGQLPLSIVLVAGILSEMEKDVECWEQVANNLGSHIHNDSRAIVDQSYHVLPCHLKSCFLYFGAFLEDRVIDISRLIRLWISEAFIKSSE

FPrintScan: PR00364
IPR000767
535-550 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
610-624 DISEASERSIST
Disease resistance protein

TLLPRRYLILVDDVW

FPrintScan: PR00364
IPR000767
704-718 DISEASERSIST
Disease resistance protein

CGQLPLSIVLVAGIL

superfamily: SSF52058
830-1245 SSF52058,LRR

RLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHKQHAHLAFTEMHNLVEWSASCSFVGSVVLSNKYEPYFHDLSSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELPYLRYFSALIDQNSIPSSISNLWNLETLILNRRSADSHNRVLLPSTVWDMVKLRHLHIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCKVKCLEYLHQYHALNFPIRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKSAMNIQETQVEDYQNTNFKLVLIEKWPKFYKLFSQLSLP

Gene3D: G3DSA:3.80.10.10
908-1052 G3DSA:3.80.10.10

SSLHDFSISRILPNFKFLKVLDLEHRVFIDFIPTELPYLRYFSALIDQNSIPSSISNLWNLETLILNRRSADSHNRVLLPSTVWDMVKLRHLHIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCK

Gene3D: G3DSA:3.80.10.10
1070-1201 G3DSA:3.80.10.10

RLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCN

FPrintScan: PR00364
IPR000767
1163-1179 DISEASERSIST
Disease resistance protein

DAFPNLEQLVLRGCQDL


List of References

Agim Ballvora, Anika Jöcker, Prisca Viehöver, Hirofumi Ishihara, Jürgen Paal, Khalid Meksem, Rémy Bruggmann, Heiko Schoof, Bernd Weisshaar, Christiane Gebhardt
Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
BMC Genomics: 2007, 8();112
PubMed:17474978 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox