PRGDB00048339 (F-box protein)

From PRG Wiki
Jump to: navigation, search
F-box protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942393 (EF514212)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig R1, complete sequence.

DNA Sequence

ATGTATTTCAACAATGAATTGTCTGATCAAAAAGTTTGTCTCCTTAGAGAGCTGAAAAATTTAAAGTACTCGGATGATGCAAGGGATCGGATAAATTTCTTTCTATGGGAGTTAAAATTCCTTGATTGTTTTCTCCATTTGAAAAGCTTCCCTTTTGCAAGTGAATGCGGTATGCTACATGTCTCACAGAAAATGATAGATATTTGGAAAAGTCATTGTTCTAAAACCATAAATGGTACGATTCTGTATTATGGTAAAGTTCCTTTGAATTTATTTGTCAACTGGAAGAAGGTAATTTGGAAGACTAAGCAAGAATTCAGAGCCCAATACTCCTTTCCGAAAACACCACTTGCAGCCAACAAGGTGATTGATGATGATGATAATACTCATAGCCCCAAATTTGTGATGGAAGTCATCGATGTTTTTGTGGAGAACCTCAATGTTCTAATGAAGATCAATGATCCATGTTCGTGGTTTTTTGTTCCAGGACACATGAAGGAACAAATAGAACAAGTTTTAAAGGAGTTGAAGTTATTGAGATTTTTTGTCTGCTTTGTTTCAAACAAATGTAGCATACAGCCTCAATACCGATGTACTACTTTTTATACTCATGCTTTAATTGAGGCTAGCCACATCGCAATGGTTGTGTGGTTGCATTTGCCAATCTATGGCAACGTAAATCAAGACTTGGCTCCAAGTGAAGTCAGTCGTTTGTTCTCTGATTTCATGGAAATGAAGATTAAGTCCATTCAGCCAGTCATCAGCCGCAACAATATTTATATTGATGTCCTGCAAGCTTTGAAGTCAACCATACCACAAGCACAAAAGAAGCATGCAGCTGAGAGTAGCACTGTGGAGATTCCAACACACAGCCTGACGGTTGGTTTGAGTGATCAAATGGCTAACCTTCAGGAGATGCTCTGCCTTCTAAGAGACAATCTCATTCATCTTCCAATACTAGATCTGGAATTTCATCTTCAAGATATGGATTCTGTTATTATTGATGCTGGACTTCTTATTTACTCGTTATATGATATCAAGAGGGAGAAGGAAGACACAGTATTGGATGATATGAACCGAGCACTTGGTTTGGATCTTCCGAGAAACATTGAGCCTATCAAGGTGATGGTCTATCTTGTCATGCAAAAGGCAATTCAATGCAACTTGCCAAAGGTTCATGGACTAGGCTATGTCGATTTTCTATTGAAAAACCTGAAGGATTTCCAAGGCCGTTATTCGGATTCACTTGCTTTCCTCAAGAATCAACTCCAAGTTATTCAAACGGAATTTGAGAGCTTGCAACCTTTCCTGAAGGTTGTCGTAGAAGAGCCACAAAATAAGCTCAAGACACTGAATGAAGATTGTGCTATACAGATAATTAGGAAAGCACATGAGGTGGAATATGTAGTTGATGCTTGTATAAACAAAGGCATTCCTCATTGGTGCCTCGAGCGTTGGCTCCAGGATATCATAGAGGAGATTACTTGTATCAAAGCAAAGATTCAGGAAAAGAACACTGTTGACGATACAATGAAGACTGTCATCGCTCGTACATCATCCAAACTGGCAAGGACTCCGAGGATGAATGAAGAAATTGTGGGGTTTAAGGATGTCATAGAAAATTTAAGAAATCAACTACTGAATGGAACCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTCTAGGTAAGACTACTTTGGCCAACAGACTCTATTCTGACAGGTCTGTTGTCTCTCACTTTGATATTTGTGCACAATGTTGTGTGTCTCAAGTATATTCTTATAAGGACTTGTTATTGGCCTTGCTATGTGATGCTATTGGTGAGGGTTCTGTGCGTAGAGAACTTCATGCCAATGAATTAGCTGATATGCTTCGCAAAACTTTATTGCCCCGAAGGTACCTTATCCTTGTTGATGATGTGTGGGAAAATAGTGTTTGGGATGATTTAAGAGGTTGTTTTCCAGATGCCAATAACAGAAGCAGAATCATTCTAACAACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCATAGTGATCCCCTTCATCTTCGTATGTTTGACGAAGATGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAACAAAGCTGTTCCCCTCTCCTAAAAAAAGTTGGGCTAAGAATAGCAAAAATGTGTGGACAACTCCCTCTTTCAATTGTTTTGGTTGCTGGTATTCTGTCAGAGATGGAAAAGGAAGTAGAATGTTGGGAACAAGTGGCCAACGATTTGGGTACCCACATTCGCAGTAACTCAAGGGCAATTGTAGACCAAAGTTATCATGTTTTACCCTGTCATCTTAAGTCTTGCTTCCTTTATTTTGGAGCATTTTTAGGGGTTAGAGAGATTCGTATTTCAAGGTTAATAAGGTTATGGATATCAGAATCATTTATAAAAAGTTGTGAAGGCAGGAGGTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTTATTGGAAGAAATCTAGTAATGGTTACTCAGAGGGCCAATTCAAATGGTAAGGTCAAAGCATGTCGCCTTCATGATGTATTACTGAACTTCTGCAAAGAAAGAGCAGCTGAGGAGAATTTACTACTATGGATAAATAGGGATCAGAGTACCAAAGCTGTTTACTCTCACAAGCAGCATGCTCACTTAGCCTTCACTAAAATGGATAATCTTGTAGAATGGAGTGCATCTTCCTCACTTGTTGGCTCTGTACTTATTATGAGATATAACCCATACTTTGCCCGTTGTCCCTTATATGCAGTTTCACACATTTTATTAAATTTCAAGTTTCTAAAAGTATTGGATTTGAAGCACCAGGTTGTTATTGATTTTATTCCAACTGAGCTTCCTTACTTGAGGTATTTAACTGCAGACATTGGTCAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAACCGTAGATCAGTTGTGCATAAGATATTACTACCTAGTACAGTTTGGGATATGGTTAAATTGAGATTTCTGTTTATTCCTAACTTCAGCCCTGAAAATAAAAAAGCATTACTCAAGAACTCTCCAAATCTTGATGATTTGGAAACCCTTTCCTATCCATATTTCGCTCGTGTTAAGGATGCAGAATTGATGCTGAGAAAAACACCTAATCTTCGAAAACTGACATGTAAAGTCAAGTGCTTAGAATACCTCCATCAGTACCATGCATTGAATTTTCCAATTCGGCTTGAAATACTAAAGCTTTATCGATCAAATGCCTTTAAAGCCATCCCCTTTTGCATCTCTGCACCAAATCTCAAATACCTGAAACTCTCTGGCTTTTACCTGGATTCTCAGTACTTATCAAAAACTGCTGATCATCTGAAGAACCTTGAGGTACTCAAACTGTACTACGTTGAATTTGGTGATCATAGGGAATGGAAAGTGAGCAATGGCATGTTCCCTCAACTCAAAATCTTGAAACTAGAGGATGTGTCCTTGATGAAATGGATTGTAGCTGATGATGCCTTTCCTAACCTTGAACAATTAGTTTTGCGTGGATGTCAAGATCTTATGGAGATCCCTTCTTGTTTCATGGACATCCTTTCCCTGCAGTACATCGAGGTAGAAGACTGCAATGAGTCGGTTGTCAAGTCAGCCATGAATATACAAGAAACACAAGTCGAAGATTATCAAAATACTAATTTCAAACTCGTTCTCATCGAGGTACACTACTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MYFNNELSDQKVCLLRELKNLKYSDDARDRINFFLWELKFLDCFLHLKSFPFASECGMLHVSQKMIDIWKSHCSKTINGTILYYGKVPLNLFVNWKKVIWKTKQEFRAQYSFPKTPLAANKVIDDDDNTHSPKFVMEVIDVFVENLNVLMKINDPCSWFFVPGHMKEQIEQVLKELKLLRFFVCFVSNKCSIQPQYRCTTFYTHALIEASHIAMVVWLHLPIYGNVNQDLAPSEVSRLFSDFMEMKIKSIQPVISRNNIYIDVLQALKSTIPQAQKKHAAESSTVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIIDAGLLIYSLYDIKREKEDTVLDDMNRALGLDLPRNIEPIKVMVYLVMQKAIQCNLPKVHGLGYVDFLLKNLKDFQGRYSDSLAFLKNQLQVIQTEFESLQPFLKVVVEEPQNKLKTLNEDCAIQIIRKAHEVEYVVDACINKGIPHWCLERWLQDIIEEITCIKAKIQEKNTVDDTMKTVIARTSSKLARTPRMNEEIVGFKDVIENLRNQLLNGTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSHFDICAQCCVSQVYSYKDLLLALLCDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEQSCSPLLKKVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANDLGTHIRSNSRAIVDQSYHVLPCHLKSCFLYFGAFLGVREIRISRLIRLWISESFIKSCEGRRLEDIAEGYLENLIGRNLVMVTQRANSNGKVKACRLHDVLLNFCKERAAEENLLLWINRDQSTKAVYSHKQHAHLAFTKMDNLVEWSASSSLVGSVLIMRYNPYFARCPLYAVSHILLNFKFLKVLDLKHQVVIDFIPTELPYLRYLTADIGQNSIPSSISNLWNLETLILNRRSVVHKILLPSTVWDMVKLRFLFIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCKVKCLEYLHQYHALNFPIRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKSAMNIQETQVEDYQNTNFKLVLIEVHY

Domains

Domain Start-End Description Sequence

HMMPfam: PF12061
IPR021929
95-503 DUF3542
Late blight resistance protein R1

WKKVIWKTKQEFRAQYSFPKTPLAANKVIDDDDNTHSPKFVMEVIDVFVENLNVLMKINDPCSWFFVPGHMKEQIEQVLKELKLLRFFVCFVSNKCSIQPQYRCTTFYTHALIEASHIAMVVWLHLPIYGNVNQDLAPSEVSRLFSDFMEMKIKSIQPVISRNNIYIDVLQALKSTIPQAQKKHAAESSTVEIPTHSLTVGLSDQMANLQEMLCLLRDNLIHLPILDLEFHLQDMDSVIIDAGLLIYSLYDIKREKEDTVLDDMNRALGLDLPRNIEPIKVMVYLVMQKAIQCNLPKVHGLGYVDFLLKNLKDFQGRYSDSLAFLKNQLQVIQTEFESLQPFLKVVVEEPQNKLKTLNEDCAIQIIRKAHEVEYVVDACINKGIPHWCLERWLQDIIEEITCIKAKIQE

HMMPanther: PTHR11017
381-874 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MQKAIQCNLPKVHGLGYVDFLLKNLKDFQGRYSDSLAFLKNQLQVIQTEFESLQPFLKVVVEEPQNKLKTLNEDCAIQIIRKAHEVEYVVDACINKGIPHWCLERWLQDIIEEITCIKAKIQEKNTVDDTMKTVIARTSSKLARTPRMNEEIVGFKDVIENLRNQLLNGTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSHFDICAQCCVSQVYSYKDLLLALLCDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEQSCSPLLKKVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANDLGTHIRSNSRAIVDQSYHVLPCHLKSCFLYFGAFLGVREIRISRLIRLWISESFIKSCEGRRLEDIAEGYLENLIGRNLVMVTQRANSNGKVKACRLHDVLLNFCKERAAEENLLLWINR

HMMPanther: PTHR11017:SF126
381-874 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

MQKAIQCNLPKVHGLGYVDFLLKNLKDFQGRYSDSLAFLKNQLQVIQTEFESLQPFLKVVVEEPQNKLKTLNEDCAIQIIRKAHEVEYVVDACINKGIPHWCLERWLQDIIEEITCIKAKIQEKNTVDDTMKTVIARTSSKLARTPRMNEEIVGFKDVIENLRNQLLNGTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSHFDICAQCCVSQVYSYKDLLLALLCDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEQSCSPLLKKVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANDLGTHIRSNSRAIVDQSYHVLPCHLKSCFLYFGAFLGVREIRISRLIRLWISESFIKSCEGRRLEDIAEGYLENLIGRNLVMVTQRANSNGKVKACRLHDVLLNFCKERAAEENLLLWINR

superfamily: SSF52540
514-762 P-loop containing nucleoside triphosphate hydrolases

VIARTSSKLARTPRMNEEIVGFKDVIENLRNQLLNGTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSHFDICAQCCVSQVYSYKDLLLALLCDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEQSCSPLLKKVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANDLGTHIRSN

Gene3D: G3DSA:3.40.50.300
526-674 no description

PRMNEEIVGFKDVIENLRNQLLNGTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSHFDICAQCCVSQVYSYKDLLLALLCDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEV

HMMPfam: PF00931
IPR002182
536-811 NB-ARC,NBS
NB-ARC

KDVIENLRNQLLNGTKGQDVISIHGMPGLGKTTLANRLYSDRSVVSHFDICAQCCVSQVYSYKDLLLALLCDAIGEGSVRRELHANELADMLRKTLLPRRYLILVDDVWENSVWDDLRGCFPDANNRSRIILTTRHHEVAKYASVHSDPLHLRMFDEDESWKLLEKKVFGEQSCSPLLKKVGLRIAKMCGQLPLSIVLVAGILSEMEKEVECWEQVANDLGTHIRSNSRAIVDQSYHVLPCHLKSCFLYFGAFLGVREIRISRLIRLWISESFIKS

FPrintScan: PR00364
IPR000767
555-570 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
630-644 DISEASERSIST
Disease resistance protein

TLLPRRYLILVDDVW

FPrintScan: PR00364
IPR000767
724-738 DISEASERSIST
Disease resistance protein

CGQLPLSIVLVAGIL

Seg: seg
792-807 seg

REIRISRLIRLWISES

superfamily: SSF52058
850-1240 L domain-like,LRR

RLHDVLLNFCKERAAEENLLLWINRDQSTKAVYSHKQHAHLAFTKMDNLVEWSASSSLVGSVLIMRYNPYFARCPLYAVSHILLNFKFLKVLDLKHQVVIDFIPTELPYLRYLTADIGQNSIPSSISNLWNLETLILNRRSVVHKILLPSTVWDMVKLRFLFIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCKVKCLEYLHQYHALNFPIRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKSAMNIQETQVEDYQNTNFKLVLI

Gene3D: G3DSA:3.80.10.10
926-1063 no description

YAVSHILLNFKFLKVLDLKHQVVIDFIPTELPYLRYLTADIGQNSIPSSISNLWNLETLILNRRSVVHKILLPSTVWDMVKLRFLFIPNFSPENKKALLKNSPNLDDLETLSYPYFARVKDAELMLRKTPNLRKLTCK

Gene3D: G3DSA:3.80.10.10
1080-1212 no description

IRLEILKLYRSNAFKAIPFCISAPNLKYLKLSGFYLDSQYLSKTADHLKNLEVLKLYYVEFGDHREWKVSNGMFPQLKILKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCN

FPrintScan: PR00364
IPR000767
1174-1190 DISEASERSIST
Disease resistance protein

DAFPNLEQLVLRGCQDL


List of References

Agim Ballvora, Anika Jöcker, Prisca Viehöver, Hirofumi Ishihara, Jürgen Paal, Khalid Meksem, Rémy Bruggmann, Heiko Schoof, Bernd Weisshaar, Christiane Gebhardt
Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
BMC Genomics: 2007, 8();112
PubMed:17474978 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox