PRGDB00048340 (F-box protein)

From PRG Wiki
Jump to: navigation, search
F-box protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 142942393 (EF514212)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum strain P6/210 contig R1, complete sequence.

DNA Sequence

ATGAAGACTGTCATTGCTCGTACATCATCAAAACTGGCAAGGACTCCGAGGATGAATGAAGAAATTGTTGGGTTTGAGGATGTCATAGAAAATTTAAGAAAAAAACTACTGAGTGAAACCAAAGGGCAAGATGTCATTTCAATTCACGGCATGCCAGGTCTAGGTAAGACGACTTTAGCCAACAGACTCTATTCTGACAGGTCAGTTGTCTCTCAATTTGATATTTGTGCACAATGCTGTGTGTCTCAAGTATATTCGTATAAGGACTTGTTATTGTCCTTGCTACGTGATGCTATTGGTGACGAATCTGGGAGCAGAGAACTGCCTGACAATGAATTAGCTGATATGCTTCGCAAAACTTTATTGCCCCGAAGGTACCTTATCCTTGTTGATGACGTGTGGGACAATAGTGCTTGGGATGATTTAAGAGGTTGTTTTCCAGATGTCAATAACAGAAGCAGAATCATTCTAACGACAAGACATCATGAAGTTGCCAAATATGCTAGTGTTCATAGTGATCCCCTTCATCTTCGTATGTTTTACGAAGATGAAAGTTGGAAGTTGCTTGAAAAGAAAGTGTTTGGTGAACAAAGCTGCTCCCCTCTCCTAAAAGATGTTGGGCTAAGAATAGCAAAATTGTGTGGAAAACTCCCTCTTTCAATTGTTTTTGTGGCTGGTACTCTGTCTGAGATGGAAAAGGAAGTAGAATCATTTTTAGAGGATAGAGTGATTGACATTTCAAGGTTAATACGGTTATGGATATCAGAATCATTTATAAAAAGTAGTGAAGGCAGAAGCTTGGAGGATATAGCAGAAGGTTACTTGGAGAATCTCATTGGAAGAAATCTAGTAATGGTTACTCAGAGGGCCGATTCAGATGGTATGGTCAAAGCATGTCGCCTTCATGATGTATTACTCGACTTCTGCAAGAAAAGAGCAGCTGAGGAGAATTTTCTACTATGTATAAAACGGGATCAGAGTACCAAAGCTGTTATTTCTCACAAGCAGCAAGCTCACTTAGCCTTCAGTAAAATGGATAATCTTGTAGAATGGAGTGCATCTTCCTCACTTGTTGGCTCTGTAATTTTTAAGAGTTATGACCCATACTTTGCCCGTTGTCCCTTATCCTCTCATGCTTTTGCACTTTCACACATTTTAATAAATTTCAAGTTTCTTAAAGTATTGGATTTGGAGCACCAGGTTGTTATTGATTTTAATCCCACTGAGCACTTTTACTTGAGGTATCTATCTGCACACATTGATCAGAATTCAATTCCTTCAAGCATATCCAATCTTTGGAACCTTGAAACTCTTATATTAAAGCGTACACCAGCTGGGAGACTTAACACGCTACTACTACCTAGTACAATTTGGGATATGGTTAAACTGAGACATCTGCATATTCCTAACTTTAGAGCAGAAAGTGAAGATGCATTACTTGAGAACTCAGCAAAACTTTATGATTTGGAAACCCTTTCCACTACATATTTCTCTAGTGTTGAGAAGGCAGAATTGATGCTGAGAAAAACACCTAATCTTCGAAAACTGATATGTGAAGTCCAGTTCTTAGAATACCCCAATCAGTACCATGTGTTGAATTTTCCAGTAAGGCTTGAAATGCTAAAGCTTTATCGATTTAATAACTCTAAAGTCATCCCCTTTTACATCTCTGCACCAAACCTCAAATACCTGAAACTCTCTGGCTTTTACCTGGATTCTCATTACTTATCAGAAACTGCTGATCATCTCAAGCACCTTGAGGTACTCAAACTGTACCGCGTTGAATTTGGCGATCATGGGGAATGGAAAGTGAGCAATGGCATGTTCCCTCAACTCAAAATCTTGAAACTAAATTATGTGTGCTTGATGAAATGGATTGTAGCTGATGATGCATTTCCTAACCTTGAACAATTGGTTTTGCGCGGATGTAAAGATCTTATGGAGATCCCTTTTTGTTTCATGGACATCCTTTCTCTGAAGTACATTGAGTTAGACAACTGCAACAAGTCTGTTGTCAAGTCAGCCAAGGATATAGAAGAAGCACAAGTCGAAGATAATCAAAATACTAATTTCAAGCTCGTCATCATCAAGAAAATGATATTGCAATTCGATATTTCTCATGACAAAGAGATAGATAATGCATTTAAAAGATTAGCCTCTCTTCCAGGAGTAGACTCAATTTCAATTGATATGATAGAAAAGAAACTTACTGTGGGTGGAGATATGAATGCTAATGAAGTTCGATTAGTTGTGGGGAAACTGATAGACAGTGGCATGCTGTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Solanum tuberosum].

MKTVIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVIDISRLIRLWISESFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRADSDGMVKACRLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEAQVEDNQNTNFKLVIIKKMILQFDISHDKEIDNAFKRLASLPGVDSISIDMIEKKLTVGGDMNANEVRLVVGKLIDSGML

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
4-245 SSF52540

VIARTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVID

HMMPanther: PTHR23155
7-715 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVIDISRLIRLWISESFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRADSDGMVKACRLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEAQVEDNQNTNFKLVIIKKMILQFDISHDKEIDNAF

HMMPanther: PTHR23155:SF121
7-715 PTHR23155:SF121,SUBFAMILY NOT NAMED

RTSSKLARTPRMNEEIVGFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVESFLEDRVIDISRLIRLWISESFIKSSEGRSLEDIAEGYLENLIGRNLVMVTQRADSDGMVKACRLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEAQVEDNQNTNFKLVIIKKMILQFDISHDKEIDNAF

Gene3D: G3DSA:3.40.50.300
24-161 G3DSA:3.40.50.300

GFEDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRH

HMMPfam: PF00931
IPR002182
26-237 NB-ARC,NBS
NB-ARC

EDVIENLRKKLLSETKGQDVISIHGMPGLGKTTLANRLYSDRSVVSQFDICAQCCVSQVYSYKDLLLSLLRDAIGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNSAWDDLRGCFPDVNNRSRIILTTRHHEVAKYASVHSDPLHLRMFYEDESWKLLEKKVFGEQSCSPLLKDVGLRIAKLCGKLPLSIVFVAGTLSEMEKEVES

FPrintScan: PR00364
IPR000767
45-60 DISEASERSIST
Disease resistance protein

VISIHGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
120-134 DISEASERSIST
Disease resistance protein

TLLPRRYLILVDDVW

FPrintScan: PR00364
IPR000767
214-228 DISEASERSIST
Disease resistance protein

CGKLPLSIVFVAGTL

superfamily: SSF52058
300-673 SSF52058,LRR

RLHDVLLDFCKKRAAEENFLLCIKRDQSTKAVISHKQQAHLAFSKMDNLVEWSASSSLVGSVIFKSYDPYFARCPLSSHAFALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKLICEVQFLEYPNQYHVLNFPVRLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVK

Gene3D: G3DSA:3.80.10.10
381-516 G3DSA:3.80.10.10

ALSHILINFKFLKVLDLEHQVVIDFNPTEHFYLRYLSAHIDQNSIPSSISNLWNLETLILKRTPAGRLNTLLLPSTIWDMVKLRHLHIPNFRAESEDALLENSAKLYDLETLSTTYFSSVEKAELMLRKTPNLRKL

Gene3D: G3DSA:3.80.10.10
537-669 G3DSA:3.80.10.10

RLEMLKLYRFNNSKVIPFYISAPNLKYLKLSGFYLDSHYLSETADHLKHLEVLKLYRVEFGDHGEWKVSNGMFPQLKILKLNYVCLMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNK

FPrintScan: PR00364
IPR000767
654-670 DISEASERSIST
Disease resistance protein

MDILSLKYIELDNCNKS


List of References

Agim Ballvora, Anika Jöcker, Prisca Viehöver, Hirofumi Ishihara, Jürgen Paal, Khalid Meksem, Rémy Bruggmann, Heiko Schoof, Bernd Weisshaar, Christiane Gebhardt
Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
BMC Genomics: 2007, 8();112
PubMed:17474978 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox