PRGDB00048342 (Rpp13)

From PRG Wiki
Jump to: navigation, search
Rpp13
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 126032755 (EF368157)
Gene Class CNL
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Ef_5 disease resistance protein Rpp13 variant (Rpp13) gene, partial cds.

DNA Sequence

GAGACGTGGCTATCAAGAAATCTAAAGAGCTCAACTTTGTAAACGTGTATAACGATCATGTGTCCCAACATTCTTCTACTACTTGCAGAAGGGAAGTGGTTCACCATCAGTTCAAGAGATACCCATCTGAGAAACGCAAGAACAAACGGATGCGATCCTTCTTATACTTTGGAGAATTAAAGTTTTTGGTAGGGCTTGATGTTGAAACAATGAAGCTACTTCGAGTGCTTGATCTTGGAGCGCTTCGGGGTCCTTTTGCAAGTAATGGGGATCTGATCCACTTGAGGTACCTTCGATTTGATGGTGATTCTCTCCGCCTTTTTGATATAGCAGCTATTATATCCAAGTTACGGTTTCTACAAACACTAGATGCATCTCACCTTTGTCCCATCTATGACACAATCGATCTCCGTAAGCTCACATCATTAAGACATGTCATAGGAAGATTCTTTGGAAATTTGCTTATAGGCGACGCAGCGAACCTTCAGACCTTGAGGTCTATCTCCTCTGACAGCTGGAGCAAACTAAAACATGAGTTGCTCATAAATCTTCGGGACTTGTTTATCTATGAGATGATTAGATCAGTTCCTGTGAGCTGGGCTTCCTTGACTAAACTAAGAAGTCTTCGTGTTCTGAAGCTGGAGACGTATGGCCGCAATTTATCGTTGGAATTGGAAGAAGCAGTTAGGTCCATGGATGTGATTTCGCCCAGTCTTGAATCCGTGACACTGGTTAGAATAACTTTCGAGGAAGACCCAATGCCTTTTTTGCAGAAAATGCCGAGACTGGAAGATCTGATCTTGGAAAATTGTGATTACTCGGGAGGGAAGATGAGCATCAGCGAACAAGGTTTTGGTAGGCTGAGGAAGCTTCAATTGGTCATGGAAAGTTTAGATGAGTTGCAGATAGAAGAAGAGGCCATGCC


Protein sequences

Name Description Sequence
disease resistance protein Rpp13 variant disease resistance protein Rpp13 variant [Arabidopsis thaliana].

DVAIKKSKELNFVNVYNDHVSQHSSTTCRREVVHHQFKRYPSEKRKNKRMRSFLYFGELKFLVGLDVETMKLLRVLDLGALRGPFASNGDLIHLRYLRFDGDSLRLFDIAAIISKLRFLQTLDASHLCPIYDTIDLRKLTSLRHVIGRFFGNLLIGDAANLQTLRSISSDSWSKLKHELLINLRDLFIYEMIRSVPVSWASLTKLRSLRVLKLETYGRNLSLELEEAVRSMDVISPSLESVTLVRITFEEDPMPFLQKMPRLEDLILENCDYSGGKMSISEQGFGRLRKLQLVMESLDELQIEEEAMP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-308 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVAIKKSKELNFVNVYNDHVSQHSSTTCRREVVHHQFKRYPSEKRKNKRMRSFLYFGELKFLVGLDVETMKLLRVLDLGALRGPFASNGDLIHLRYLRFDGDSLRLFDIAAIISKLRFLQTLDASHLCPIYDTIDLRKLTSLRHVIGRFFGNLLIGDAANLQTLRSISSDSWSKLKHELLINLRDLFIYEMIRSVPVSWASLTKLRSLRVLKLETYGRNLSLELEEAVRSMDVISPSLESVTLVRITFEEDPMPFLQKMPRLEDLILENCDYSGGKMSISEQGFGRLRKLQLVMESLDELQIEEEAMP

HMMPanther: PTHR11017:SF14
1-308 PTHR11017:SF14

DVAIKKSKELNFVNVYNDHVSQHSSTTCRREVVHHQFKRYPSEKRKNKRMRSFLYFGELKFLVGLDVETMKLLRVLDLGALRGPFASNGDLIHLRYLRFDGDSLRLFDIAAIISKLRFLQTLDASHLCPIYDTIDLRKLTSLRHVIGRFFGNLLIGDAANLQTLRSISSDSWSKLKHELLINLRDLFIYEMIRSVPVSWASLTKLRSLRVLKLETYGRNLSLELEEAVRSMDVISPSLESVTLVRITFEEDPMPFLQKMPRLEDLILENCDYSGGKMSISEQGFGRLRKLQLVMESLDELQIEEEAMP

superfamily: SSF52058
61-294 SSF52058,LRR

FLVGLDVETMKLLRVLDLGALRGPFASNGDLIHLRYLRFDGDSLRLFDIAAIISKLRFLQTLDASHLCPIYDTIDLRKLTSLRHVIGRFFGNLLIGDAANLQTLRSISSDSWSKLKHELLINLRDLFIYEMIRSVPVSWASLTKLRSLRVLKLETYGRNLSLELEEAVRSMDVISPSLESVTLVRITFEEDPMPFLQKMPRLEDLILENCDYSGGKMSISEQGFGRLRKLQLVM

Gene3D: G3DSA:3.80.10.10
87-292 G3DSA:3.80.10.10

SNGDLIHLRYLRFDGDSLRLFDIAAIISKLRFLQTLDASHLCPIYDTIDLRKLTSLRHVIGRFFGNLLIGDAANLQTLRSISSDSWSKLKHELLINLRDLFIYEMIRSVPVSWASLTKLRSLRVLKLETYGRNLSLELEEAVRSMDVISPSLESVTLVRITFEEDPMPFLQKMPRLEDLILENCDYSGGKMSISEQGFGRLRKLQL


List of References

Jing Ding, Weili Zhang, Zhiqiang Jing, Jian-Qun Chen, Dacheng Tian
Unique pattern of R-gene variation within populations in Arabidopsis.
Mol. Genet. Genomics: 2007, 277(6);619-29
PubMed:17277944 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox