PRGDB00048347 (Rpp13)

From PRG Wiki
Jump to: navigation, search
Rpp13
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 126032745 (EF368152)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ecotype Sq_11 truncated disease resistance protein Rpp13 (Rpp13) gene, partial cds.

DNA Sequence

GAGACGTGGCTATCAAGAAATCTAAAGAGCTCAACTTTGTAAACGTGTATAACGATCATGTGGCCCAACATTCTTCTACTACTTGCAGAAGGGAAGTGGTTCACCATCAGTTCAAGAGATACTCATATGAGAAATGCAAGAACAAACGGATGCGATCCTTCTTATACTTTGGAGAATCATACAATTTGGTAGAGCGTGATTTTGAAACAACGAAGCTACTTCGAGTGCTTGATGTCAGAAGGCATGGGGTCCTTCGAAAATTATTGGGGATCAGATCCACTTGA


Protein sequences

Name Description Sequence
truncated disease resistance protein Rpp13 truncated disease resistance protein Rpp13 [Arabidopsis thaliana].

DVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYSYEKCKNKRMRSFLYFGESYNLVERDFETTKLLRVLDVRRHGVLRKLLGIRST



List of References

Jing Ding, Weili Zhang, Zhiqiang Jing, Jian-Qun Chen, Dacheng Tian
Unique pattern of R-gene variation within populations in Arabidopsis.
Mol. Genet. Genomics: 2007, 277(6);619-29
PubMed:17277944 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox