PRGDB00048561 (AT4g36180)

From PRG Wiki
Jump to: navigation, search
AT4g36180
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7270525 (AL161588)
Gene Class TNL
Domain Type LRR, LRR, NBS, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84.

DNA Sequence

GAACTCAACAAATCTTTGGCTCTCAACTTTACTGTGCCTTCACCTGAAAGTAAAAATATCACATTTGATCTGCAACCAGGGTCTTCCGTGATCATACAACTGGGTTCTTCATGGAGACTCATTCGCGGTTTTGCTATTTTAGTCGAAGTTGCATTTTTGGAGGAATACCAGGCTGGTGCTTTTAGCATTAGTTGTGTTTGCAGATGGAAAGACACTGAATGTGTATCTCATAGGCTGGAAAAAAACTTCCATTGTTGGATTCCAGGGGAAGGTGTTCCCAAGGATCACATGTTTGTCTTCTGTGATTTCGATATGCATCTGACTGCCTGTGAAGGAAATGACTCCAGTATATTGGCTGATCTTGTCGTATTTGAATTCTTTACTGTGAACAAGCAGAAAAAGCTTCTAGATGGGAGTTGTGCAGTGACGAGATGTGGAGTCCATGTTTTTACTGCTGCAAATGAAGATACTAGTTCTAGCATGACTAAACCATTTTCGTCCTCGGGTTACCTGCAGGAGATTTTTGATAATGAAGTTGAGGAATTGAGGGTTATCTATGATGGCTTAGACGAGAATGATAGAAATTTATTACTTTACATGGCATATCTGAATGGCGAGGAAGCTGATTTCTTGGCACCCCTTATAGCTAGCACTGGCTTGGGGATTAGTTCTAGGCTCAATGTCTTAGCCAATAAGTCTCTCATAAACATATCTCCGTATGGTATCATAGTACGGCAAGGTTTACTTAAGAAAATAGGTAGGGAGATAGTCTATAGAAGTGTTTACTTAAGCAGCCTCAACGACACTCTGCCTGGTAGCTCAACAGTGTCGTTGAGGCTGGCTGCGGTTAAAGAGCCTAAAGTTACAACGTTTAAAGTCCCGAGAGTTAGAAGTGTGAAACAAGATGAATTTAATGCTAAAATTAATGCCTTTATCAGCCGATTTAAGCAAAAACCTCAATAGAGCCTCGAGATGCTGAAGGTGGTCAAGCTTTGTCATTCCCAACAGCTTACTGCGATTGACGATATTTTAAAAGCTCAAAATATCGAGCTAATTGATCTCCAAGGCTGTAGAAAATTGCAGAGGTTTCCAGCCACGGGTCAATTACAACATCTCCGAGTTGTAAATCTCTCAGGTTGTAGAGAGATCAAAAGTTTCCCAGAAGTTTCACCAAATATTGAGGAACTACATCTCCAGGGAACTGGCATAAGAGAATTACCAATATCCATTGTGTCCCTCTTCGAACAAGCTAAGTTGAATCGAGAGCTTTTCAATCTCCTACCAGAATTCTCAGGTGTTTCAAATGCTTGGAACAATGAGCAATCAACAAGCCTGGCCAAATTAGTCACGTCTACTCAAAATCTTGGCAAACTTGTTTGCCTGAATATGAAAGATTGTGTTCATTTGCGAAAACTGCCTTACATGGTTGATTTCGAATCTCTTAAAGTTCTTAATCTGTCTGGATGCTCAGATCTCGACGATATTGAGGGTTTCCCGCCAAATCTGAAAGAGTTATATCTTGTTAGCACTGCCTTAAAAGAACTTCCACAGCTTCCCCAAAGTCTAGAAGTCTTGAATGCACATGGTTGTGTGTCTCTTTTATCAATTCCTTCCAATTTTGAGCGGCTTCCTAGGTATTACACATTCAGTAATTGCTTTGCTCTTTCTGCAAGCGTGGTCAATGAATTTGTAAAGAACGCTCTGACTAATGTAGCACACATCGCGAGAGAGAAACAGGGCACTGAAGATATCGAAGGCATACTTCTGGACACATCGAACTTAACATTTGATGTGAAGCCTGGTGCCTTTGAGAATATGCTAAGCCTTAGATTCCTGAAGATTTATTGTTCCAGTTATGAAAACCATTATAGCCTCCGCCTTCCGAAAGGACTTAAGTTTCTGCCTGATGAGCTAAGACTCCTCCACTGGGAGAACTATCCTTTGCAATCCTTGCCACAAGACTTTGATCCATGCCACCTTGTTGAACTCAATCTCTCTTACAGTCAGCTTCAGAAACTTTGGGCAGGAACCAAGGGAGGAATGCAGTGAGAGCGAACTTGTGGAAGAGATTGTCAAAGATGTGCATGAGAAACTCTTTCCCACGGAACAAATCGGAATCAACTCGAGGCTGCTGGAGATGGAACATTTGCTTTGCAAGCAACCATGGGGTGTCCGTCGCATAGGAATTTGGGGTATGCCCGGCATAGGCAAAACTACACTTGCTAAAGCATTTTTTGACCAAATCTCTGGTGGCTATGAAGCTTCTTGTTTCATCAAACACTTTGACAAGGCTTTTAGTGGGAAGGGGCTTCACCGTTTGCTGGAGGAACATTTTGGGAAAATTTTGAAGGAATTGCCTCGTGTATGCAGTAGCATTACGAGACCTAGCCTCCCCAGGGACAAATTAAGCAAGAAGAGAACTCTTGTTGTTCTTGATGATGTGCACAATCCTTTGGTTGCCGAGTCTTTTCTCGAAGGGTTTCATTGGTTCGGCCCGGGAAGCCTAATCATCATAACGTCCAGAGATAAACAAGTGTTCCGCCTTTGTCAGATCAATCATGTGTATGAGGTTCAGAGCTTTAATGAGAATGAGGCTCTGCAGCTGTTCTCTCAGTGTGCTTTTAGAAGAGATATAAATGAACAAAATCTGCTGGAACTATCACTGAAAGTGATTGACTATGCTAGTGGAAATCCATTAGCTCTCAGCTTTTACTGCAGAGTGCTTAAGGGAAAGGAACTTTCAGAAATGGAGACTACATTCTTCAAACTCAAACAACGAACTCCATATAAGATTTTTGATTTGTTCAAGAGCAGCTACGAAACACTTGATGACAACGAGAAGAACATTTTTCTGGACATTGCTTGTTTCTTCAGTGGAGAAAATGTTGACTATGTGATGCGACTACTTGAGGGGTGTGGTTTTTTTCCACATGTTGGGATTGATGTTCTTGTGGAGAACTGTCTGGTGACTATTTCAGAAAACAGAGTGAAAATGCATAGAATAATCCAAGACTTTGGCCGAGAAATAATCGATGGAGAAACAGTACAGATCGAGAGGCGTCGCAGACTGTCAGATCCTTGGAGCATCAAATTCCTTCTTGAAGATGACGAACTCGAAGCAAATGAAGATCCCAAAGCAACATATACTCGTACTCTGGGATGATGAAAAGGCTATGGTCAAAAAAATAGCTAATGATATTTCTAGTATAATGAATAATTCCACTCAATCAAGTGCTTCCCAAGGCTTAGTTGGGATGGAAGCTCATATGGAAAAGATGAAAGAGCTGCTAGGTCTGGACTCAAATAAAGTCAGATTGATAGGTATATGTGGTCTTCCTGGGAGTGGTAAAACCACCATCGCTAAACGTTTATACCAACAACTCCTTCCTCAATTCGAATTGAGTACTATCATTATTGATATCAAAGGATGCTATCCAAGAACTTGCTACAATGAGGACGACAGGAAACTGCAGTTACAAAGCCATTTACTGTCTCAACTATTAAATCACAAGTTTACTGGTGAGATTCTTCAATTGGAAGCTGCACATGAAATGTTGAAAGACAAGAAAGTGGTACTTGTTCTTGATGATGTGGACAGCATAGGACAATTAGATGCCTTGGCAAACGAAGCTCGGTGGTTTGGTCCTGGAAGTCGGATTATCATCACAACACAAGATCAAAGACTTTTAGAGGAACAAGGGATCCAATATATATACAACGTGGATTTTCCGCCACCTAATGGATTACTTCCCACTGTCTACATATACTGCGAAGATACACTACAATACTCCTTCGCCAGCCACCTCTCCATGGATTTTCGCCGGAAAGGAATTTCTGCATTTGTAAATTACAGTGAGACTCTGGATGTGATTGAGAGAGTTAGCGCTTCCGTGCTGGTTTTCTCAAAGAGCTGCGTCTCCTCCACCTCATGCCTGGACATGCTCGTGAGGGTCTTTCAGTGTCGGAGGAAAACCGGCCAGCTGGTGGTTCCTGTGTATTATGGCATTAGTTCATCAGATGTGGTGGTGCAGGAGCACAAGTCAGTGGACCGGATAAGAGAATGGAGTAGCGCACTCCAAGAACTGAGAGAATTACCAGGCCACCACAATAGGTCCATAAAGATTGATGATACGGCTATGAACAAGCACAGAGAAGAATGTGAGAGAAAAAACAAAGAGGACATTGATAGATGGATTAAAGCTTTGGAGCAAGTGGCCACAATCGATGGTTACCGTTCACGCGACTGATGGATTATTCCTCTGCTTCCCTCCTTAGGATCTGTGCGGCTGCAATCACGATTTTGGGTACGGTTTCATTTCTGATTTATGAAAAATTCATCAGATCCAATCCGCAGAAGAAGAAGAAGATAACGGCTTCGTCTCGCAATTGGGAACACAATGTGTTCTCGAGCTTCAGCTCTGTAGATGTACCCAAATCCTTTCTCAGTAGGATTAGGAAAGAGTTAAGAAGAAAGGGTTTCGAGCCACTAATCGATAATGAAACCGAGAGGTGCGTGTCGATCGGACCTGAGCTCAGAAACGCGATTAGTGTCTCGAGAATCGTGATTGTCGTGCTCTCAAGGAACTACGCTCTCTCTCCGTGGTGTCTCGACGAGTTGGTGGAGATAATGAAGTGCAAAGAAGAGTTGGGTCAAAGAGTGGTGACTATTTTCTATAATTTGGATCCAATTGATGTATTGAAGCAGACTGGAGATTTTGGGGATAATTTCAGAAAAACACGAAAGGGTAAAACAGATGAAGACATTTGGAAATGCACTAGAGCTTTGGCGGAATTGCCTAGAGTCTATAAACTTACCAGCCGCTT


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDYSSASLLRICAAAITILGTVSFLIYEKFIRSNPQKKKKITASSRNWEHNVFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNETERCVSIGPELRNAISVSRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWKCTRALAELPRVYKLTSRLSIKIDDTAMNKHREECERKNKEDIDRWIKALEQVATIDGYRSRDWDDEKAMVKKIANDISSIMNNSTQSSASQGLVGMEAHMEKMKELLGLDSNKVRLIGICGLPGSGKTTIAKRLYQQLLPQFELSTIIIDIKGCYPRTCYNEDDRKLQLQSHLLSQLLNHKFTGEILQLEAAHEMLKDKKVVLVLDDVDSIGQLDALANEARWFGPGSRIIITTQDQRLLEEQGIQYIYNVDFPPPNGLLPTVYIYCEDTLQYSFASHLSMDFRRKGISAFVNYSETLDVIERVSASVLVFSKSCVSSTSCLDMLVRVFQCRRKTGQLVVPVYYGISSSDVVVQEHKSVDRIREWSSALQELRELPGHHNREECSESELVEEIVKDVHEKLFPTEQIGINSRLLEMEHLLCKQPWGVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLEGFHWFGPGSLIIITSRDKQVFRLCQINHVYEVQSFNENEALQLFSQCAFRRDINEQNLLELSLKVIDYASGNPLALSFYCRVLKGKELSEMETTFFKLKQRTPYKIFDLFKSSYETLDDNEKNIFLDIACFFSGENVDYVMRLLEGCGFFPHVGIDVLVENCLVTISENRVKMHRIIQDFGREIIDGETVQIERRRRLSDPWSIKFLLEDDELEANEDPKATYTRTLGTEDIEGILLDTSNLTFDVKPGAFENMLSLRFLKIYCSSYENHYSLRLPKGLKFLPDELRLLHWENYPLQSLPQDFDPCHLVELNLSYSQLQKLWAGTKSLEMLKVVKLCHSQQLTAIDDILKAQNIELIDLQGCRKLQRFPATGQLQHLRVVNLSGCREIKSFPEVSPNIEELHLQGTGIRELPISIVSLFEQAKLNRELFNLLPEFSGVSNAWNNEQSTSLAKLVTSTQNLGKLVCLNMKDCVHLRKLPYMVDFESLKVLNLSGCSDLDDIEGFPPNLKELYLVSTALKELPQLPQSLEVLNAHGCVSLLSIPSNFERLPRYYTFSNCFALSASVVNEFVKNALTNVAHIAREKQELNKSLALNFTVPSPESKNITFDLQPGSSVIIQLGSSWRLIRGFAILVEVAFLEEYQAGAFSISCVCRWKDTECVSHRLEKNFHCWIPGEGVPKDHMFVFCDFDMHLTACEGNDSSILADLVVFEFFTVNKQKKLLDGSCAVTRCGVHVFTAANEDTSSSMTKPFSSSGYLQEIFDNEVEELRVIYDGLDENDRNLLLYMAYLNGEEADFLAPLIASTGLGISSRLNVLANKSLINISPYGIIVRQGLLKKIGREIVYRSVYLSSLNDTLPGSSTVSLRLAAVKEPKVTTFKVPRVRSVKQDEFNAKINAFISRFKQKPQ

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
44-189 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSRNWEHNVFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNETERCVSIGPELRNAISVSRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWKCTRALAELPRVYKL

Gene3D: G3DSA:3.40.50.10140
45-178 G3DSA:3.40.50.10140

SRNWEHNVFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNETERCVSIGPELRNAISVSRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWKCTR

ProfileScan: PS50104
IPR000157
48-175 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WEHNVFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNETERCVSIGPELRNAISVSRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWK

HMMSmart: SM00255
IPR000157
49-230 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EHNVFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNETERCVSIGPELRNAISVSRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWKCTRALAELPRVYKLTSRLSIKIDDTAMNKHREECERKNKEDIDRWIKALEQVATI

HMMPfam: PF01582
IPR000157
52-181 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNETERCVSIGPELRNAISVSRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWKCTRALA

superfamily: SSF52540
103-429 SSF52540

SRIVIVVLSRNYALSPWCLDELVEIMKCKEELGQRVVTIFYNLDPIDVLKQTGDFGDNFRKTRKGKTDEDIWKCTRALAELPRVYKLTSRLSIKIDDTAMNKHREECERKNKEDIDRWIKALEQVATIDGYRSRDWDDEKAMVKKIANDISSIMNNSTQSSASQGLVGMEAHMEKMKELLGLDSNKVRLIGICGLPGSGKTTIAKRLYQQLLPQFELSTIIIDIKGCYPRTCYNEDDRKLQLQSHLLSQLLNHKFTGEILQLEAAHEMLKDKKVVLVLDDVDSIGQLDALANEARWFGPGSRIIITTQDQRLLEEQGIQYIYNVDFP

Gene3D: G3DSA:3.40.50.300
268-418 G3DSA:3.40.50.300

LVGMEAHMEKMKELLGLDSNKVRLIGICGLPGSGKTTIAKRLYQQLLPQFELSTIIIDIKGCYPRTCYNEDDRKLQLQSHLLSQLLNHKFTGEILQLEAAHEMLKDKKVVLVLDDVDSIGQLDALANEARWFGPGSRIIITTQDQRLLEEQ

HMMPfam: PF00931
IPR002182
272-419 NB-ARC,NBS
NB-ARC

EAHMEKMKELLGLDSNKVRLIGICGLPGSGKTTIAKRLYQQLLPQFELSTIIIDIKGCYPRTCYNEDDRKLQLQSHLLSQLLNHKFTGEILQLEAAHEMLKDKKVVLVLDDVDSIGQLDALANEARWFGPGSRIIITTQDQRLLEEQG

HMMSmart: SM00382
IPR003593
288-427 AAA,NBS
AAA+ ATPase domain

KVRLIGICGLPGSGKTTIAKRLYQQLLPQFELSTIIIDIKGCYPRTCYNEDDRKLQLQSHLLSQLLNHKFTGEILQLEAAHEMLKDKKVVLVLDDVDSIGQLDALANEARWFGPGSRIIITTQDQRLLEEQGIQYIYNVD

superfamily: SSF52200
IPR000157
424-553 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YNVDFPPPNGLLPTVYIYCEDTLQYSFASHLSMDFRRKGISAFVNYSETLDVIERVSASVLVFSKSCVSSTSCLDMLVRVFQCRRKTGQLVVPVYYGISSSDVVVQEHKSVDRIREWSSALQELRELPGH

HMMPanther: PTHR11017
430-1543 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PPNGLLPTVYIYCEDTLQYSFASHLSMDFRRKGISAFVNYSETLDVIERVSASVLVFSKSCVSSTSCLDMLVRVFQCRRKTGQLVVPVYYGISSSDVVVQEHKSVDRIREWSSALQELRELPGHHNREECSESELVEEIVKDVHEKLFPTEQIGINSRLLEMEHLLCKQPWGVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLEGFHWFGPGSLIIITSRDKQVFRLCQINHVYEVQSFNENEALQLFSQCAFRRDINEQNLLELSLKVIDYASGNPLALSFYCRVLKGKELSEMETTFFKLKQRTPYKIFDLFKSSYETLDDNEKNIFLDIACFFSGENVDYVMRLLEGCGFFPHVGIDVLVENCLVTISENRVKMHRIIQDFGREIIDGETVQIERRRRLSDPWSIKFLLEDDELEANEDPKATYTRTLGTEDIEGILLDTSNLTFDVKPGAFENMLSLRFLKIYCSSYENHYSLRLPKGLKFLPDELRLLHWENYPLQSLPQDFDPCHLVELNLSYSQLQKLWAGTKSLEMLKVVKLCHSQQLTAIDDILKAQNIELIDLQGCRKLQRFPATGQLQHLRVVNLSGCREIKSFPEVSPNIEELHLQGTGIRELPISIVSLFEQAKLNRELFNLLPEFSGVSNAWNNEQSTSLAKLVTSTQNLGKLVCLNMKDCVHLRKLPYMVDFESLKVLNLSGCSDLDDIEGFPPNLKELYLVSTALKELPQLPQSLEVLNAHGCVSLLSIPSNFERLPRYYTFSNCFALSASVVNEFVKNALTNVAHIAREKQELNKSLALNFTVPSPESKNITFDLQPGSSVIIQLGSSWRLIRGFAILVEVAFLEEYQAGAFSISCVCRWKDTECVSHRLEKNFHCWIPGEGVPKDHMFVFCDFDMHLTACEGNDSSILADLVVFEFFTVNKQKKLLDGSCAVTRCGVHVFTAANEDTSSSMTKPFSSSGYLQEIFDNEVEELRVIYDGLDENDRNLLLYMAYLNGEEADFLAPLIASTGLGISSRLNVLANKSLINISPYGIIVRQGLLKKIGREI

HMMPanther: PTHR11017:SF20
430-1543 PTHR11017:SF20,SUBFAMILY NOT NAMED

PPNGLLPTVYIYCEDTLQYSFASHLSMDFRRKGISAFVNYSETLDVIERVSASVLVFSKSCVSSTSCLDMLVRVFQCRRKTGQLVVPVYYGISSSDVVVQEHKSVDRIREWSSALQELRELPGHHNREECSESELVEEIVKDVHEKLFPTEQIGINSRLLEMEHLLCKQPWGVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLEGFHWFGPGSLIIITSRDKQVFRLCQINHVYEVQSFNENEALQLFSQCAFRRDINEQNLLELSLKVIDYASGNPLALSFYCRVLKGKELSEMETTFFKLKQRTPYKIFDLFKSSYETLDDNEKNIFLDIACFFSGENVDYVMRLLEGCGFFPHVGIDVLVENCLVTISENRVKMHRIIQDFGREIIDGETVQIERRRRLSDPWSIKFLLEDDELEANEDPKATYTRTLGTEDIEGILLDTSNLTFDVKPGAFENMLSLRFLKIYCSSYENHYSLRLPKGLKFLPDELRLLHWENYPLQSLPQDFDPCHLVELNLSYSQLQKLWAGTKSLEMLKVVKLCHSQQLTAIDDILKAQNIELIDLQGCRKLQRFPATGQLQHLRVVNLSGCREIKSFPEVSPNIEELHLQGTGIRELPISIVSLFEQAKLNRELFNLLPEFSGVSNAWNNEQSTSLAKLVTSTQNLGKLVCLNMKDCVHLRKLPYMVDFESLKVLNLSGCSDLDDIEGFPPNLKELYLVSTALKELPQLPQSLEVLNAHGCVSLLSIPSNFERLPRYYTFSNCFALSASVVNEFVKNALTNVAHIAREKQELNKSLALNFTVPSPESKNITFDLQPGSSVIIQLGSSWRLIRGFAILVEVAFLEEYQAGAFSISCVCRWKDTECVSHRLEKNFHCWIPGEGVPKDHMFVFCDFDMHLTACEGNDSSILADLVVFEFFTVNKQKKLLDGSCAVTRCGVHVFTAANEDTSSSMTKPFSSSGYLQEIFDNEVEELRVIYDGLDENDRNLLLYMAYLNGEEADFLAPLIASTGLGISSRLNVLANKSLINISPYGIIVRQGLLKKIGREI

HMMSmart: SM00255
IPR000157
435-575 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LPTVYIYCEDTLQYSFASHLSMDFRRKGISAFVNYSETLDVIERVSASVLVFSKSCVSSTSCLDMLVRVFQCRRKTGQLVVPVYYGISSSDVVVQEHKSVDRIREWSSALQELRELPGHHNREECSESELVEEIVKDVHEK

HMMPfam: PF01582
IPR000157
440-536 TIR
Toll/interleukin-1 receptor homology (TIR) domain

IYCEDTLQYSFASHLSMDFRRKGISAFVNYSETLDVIERVSASVLVFSKSCVSSTSCLDMLVRVFQCRRKTGQLVVPVYYGISSSDVVVQEHKSVDR

superfamily: SSF52540
564-809 SSF52540

LVEEIVKDVHEKLFPTEQIGINSRLLEMEHLLCKQPWGVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLEGFHWFGPGSLIIITSRDKQVFRLCQINHVYEVQSFNENEALQLFSQCAFRRDINEQNLLELSLKVIDYASGNPLALSFYCRVLKGKELSEMETTFFKLKQRTPYKI

Gene3D: G3DSA:3.40.50.300
595-703 G3DSA:3.40.50.300

LCKQPWGVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLE

HMMPfam: PF00931
IPR002182
600-854 NB-ARC,NBS
NB-ARC

WGVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLEGFHWFGPGSLIIITSRDKQVFRLCQINHVYEVQSFNENEALQLFSQCAFRRDINEQNLLELSLKVIDYASGNPLALSFYCRVLKGKELSEMETTFFKLKQRTPYKIFDLFKSSYETLDDNEKNIFLDIACFFSGENVDYVMRLLEGCGFFP

HMMSmart: SM00382
IPR003593
601-762 AAA,NBS
AAA+ ATPase domain

GVRRIGIWGMPGIGKTTLAKAFFDQISGGYEASCFIKHFDKAFSGKGLHRLLEEHFGKILKELPRVCSSITRPSLPRDKLSKKRTLVVLDDVHNPLVAESFLEGFHWFGPGSLIIITSRDKQVFRLCQINHVYEVQSFNENEALQLFSQCAFRRDINEQNLL

FPrintScan: PR00364
IPR000767
604-619 DISEASERSIST
Disease resistance protein

RIGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
679-693 DISEASERSIST
Disease resistance protein

KLSKKRTLVVLDDVH

FPrintScan: PR00364
IPR000767
772-786 DISEASERSIST
Disease resistance protein

ASGNPLALSFYCRVL

superfamily: SSF46785
807-912 SSF46785

YKIFDLFKSSYETLDDNEKNIFLDIACFFSGENVDYVMRLLEGCGFFPHVGIDVLVENCLVTISENRVKMHRIIQDFGREIIDGETVQIERRRRLSDPWSIKFLLE

superfamily: SSF52058
875-1258 SSF52058,LRR

KMHRIIQDFGREIIDGETVQIERRRRLSDPWSIKFLLEDDELEANEDPKATYTRTLGTEDIEGILLDTSNLTFDVKPGAFENMLSLRFLKIYCSSYENHYSLRLPKGLKFLPDELRLLHWENYPLQSLPQDFDPCHLVELNLSYSQLQKLWAGTKSLEMLKVVKLCHSQQLTAIDDILKAQNIELIDLQGCRKLQRFPATGQLQHLRVVNLSGCREIKSFPEVSPNIEELHLQGTGIRELPISIVSLFEQAKLNRELFNLLPEFSGVSNAWNNEQSTSLAKLVTSTQNLGKLVCLNMKDCVHLRKLPYMVDFESLKVLNLSGCSDLDDIEGFPPNLKELYLVSTALKELPQLPQSLEVLNAHGCVSLLSIPSNFERLPRYYTFS

Gene3D: G3DSA:3.80.10.10
940-1125 G3DSA:3.80.10.10

LDTSNLTFDVKPGAFENMLSLRFLKIYCSSYENHYSLRLPKGLKFLPDELRLLHWENYPLQSLPQDFDPCHLVELNLSYSQLQKLWAGTKSLEMLKVVKLCHSQQLTAIDDILKAQNIELIDLQGCRKLQRFPATGQLQHLRVVNLSGCREIKSFPEVSPNIEELHLQGTGIRELPISIVSLFEQA

HMMPfam: PF07725
IPR011713
1010-1029 LRR_3
Leucine-rich repeat 3

HLVELNLSYSQLQKLWAGTK

Gene3D: G3DSA:3.80.10.10
1148-1253 G3DSA:3.80.10.10

EQSTSLAKLVTSTQNLGKLVCLNMKDCVHLRKLPYMVDFESLKVLNLSGCSDLDDIEGFPPNLKELYLVSTALKELPQLPQSLEVLNAHGCVSLLSIPSNFERLPR

FPrintScan: PR00364
IPR000767
1184-1200 DISEASERSIST
Disease resistance protein

VDFESLKVLNLSGCSDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox