PRGDB00048563 (AT4g14050)

From PRG Wiki
Jump to: navigation, search
AT4g14050
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7268064 (AL161537)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 37.

DNA Sequence

ATGAGTAGCCTTTCCAAACTGGAGGCTTTTGATATAGATGGAAATTCATTTTCTGGAACTATTCCCTCTTCTCTCTTCATGATCCCTTCGTTGGACAGACTTAACCTGGGAAGAAACCACTTCAGCGGTCCACTTGAGATTGGGAATATATCTTCACAATCTAATCTTCAAATTTTATACATTGGAGAAAACAATTTCGATGGACCAATCCCAAGATCTATATCGAAGCTAGTCGGGCTCTCAGAACTTAGCCTTTCTTTCTGGAACACAAGGAGGAGCATCGTTGATTTCAGCATCTTCTTGCATCTCAAGTCACTAGAGTCACTTGACCTCTCCTATCTGAATACAAGAAGCATGGTTGAGTTCAGTCTTTTCTCACCTCTCATGTCACTTGGTTATTTGGATCTTTCGGGGATTAGTTTGAAGTTCAGTTCAACTCTCCATCTTCCCTCCTCACTCATAGAATACTTGATTTTAACGTCCTGCAATATTTCCGAGTTTCCCACGTTTCTACAAAACCAAACCAGTTTGGAGTATTTAGACATCTCTGCCAATCAAATTGAAGGCCAGCTATCAGGACAACTTCCCAAGTCTCTGATCAAATGCACTGACCTCGAGTTTCTGAACGTGGAAGATAACAGAATCAATGACAAATTTCCATTTTGGTTGAGATCGTTGTCCAATCTACAGATTCTTGTCCTTCGTTCTAATGAGTTCTATGGGCCAATATTTTCTCCTGGAGATTCTTTGAGTTTCCCCAAGTTGCGAATCTTTGATATTTCGGAAAATCGCTTCACTGGAGTCTTGCCATCAGATTACTTTGTTGGTTGGAGTGCAATGTTATCGGTCGTAAGCATTTATGATAGTACACGTGGGTATGCGGTTCTAGGAGCTATCCGAGAAGCCTACCATAAATCTGTGGTTCTGACGAACAAAGGATTAAATATGGAGCTGGTTGGGAGTGGTTTCACAATCTACAAAACCATTGATGTCTCCGGAAACAGACTCGAAGGAGATATTCCAGAATCGATTGGTATACTCAAGGAACTGATTGTGCTCAACATGTCAAACAACGCTTTCACAGGCCATATTCCACCATCTCTATCAAACTTGAGCAATCTCCAATCATTGGATCTATCTCAAAACAGATTATCCGGCAGTATCCCAGGAGAGCTCGGGGAACTCACATTTCTAGCGCGGATGAACTTCTCTTACAACAGGCTTGAAGGTCCAATACCACAAACCACTCAGATTCAAACCCAGGATAGTTCTTCATTTACAGGGAATCCCAGTCTATGTGGTGCTCCTCTCGAAGAACCCTGCGGCCGAGAAGAAGATGAAGAAGCAACGAAGCAAGAACAAGATGAAGACAAGGAAGAGGAAGATCAAGTATTTAGCTGGATAGCAGCTGAAATAGGCTATGTACCTGGTTTGTTTTGTGGACTCGCCATCGGCCACATTCTCACTTCATATAAACTTGACTGGTTCATGAGAATCTTTTCCTGCTTTTCTTCTCCGCTGATAAAATGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MSSLSKLEAFDIDGNSFSGTIPSSLFMIPSLDRLNLGRNHFSGPLEIGNISSQSNLQILYIGENNFDGPIPRSISKLVGLSELSLSFWNTRRSIVDFSIFLHLKSLESLDLSYLNTRSMVEFSLFSPLMSLGYLDLSGISLKFSSTLHLPSSLIEYLILTSCNISEFPTFLQNQTSLEYLDISANQIEGQLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSPGDSLSFPKLRIFDISENRFTGVLPSDYFVGWSAMLSVVSIYDSTRGYAVLGAIREAYHKSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTGNPSLCGAPLEEPCGREEDEEATKQEQDEDKEEEDQVFSWIAAEIGYVPGLFCGLAIGHILTSYKLDWFMRIFSCFSSPLIK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-495 PTHR24420,FAMILY NOT NAMED

MSSLSKLEAFDIDGNSFSGTIPSSLFMIPSLDRLNLGRNHFSGPLEIGNISSQSNLQILYIGENNFDGPIPRSISKLVGLSELSLSFWNTRRSIVDFSIFLHLKSLESLDLSYLNTRSMVEFSLFSPLMSLGYLDLSGISLKFSSTLHLPSSLIEYLILTSCNISEFPTFLQNQTSLEYLDISANQIEGQLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSPGDSLSFPKLRIFDISENRFTGVLPSDYFVGWSAMLSVVSIYDSTRGYAVLGAIREAYHKSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTGNPSLCGAPLEEPCGREEDEEATKQEQDEDKEEEDQVFSWIAAEIGYVPGLFCGLAIGHILTSYKLDW

HMMPanther: PTHR24420:SF473
1-495 PTHR24420:SF473,SUBFAMILY NOT NAMED

MSSLSKLEAFDIDGNSFSGTIPSSLFMIPSLDRLNLGRNHFSGPLEIGNISSQSNLQILYIGENNFDGPIPRSISKLVGLSELSLSFWNTRRSIVDFSIFLHLKSLESLDLSYLNTRSMVEFSLFSPLMSLGYLDLSGISLKFSSTLHLPSSLIEYLILTSCNISEFPTFLQNQTSLEYLDISANQIEGQLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSPGDSLSFPKLRIFDISENRFTGVLPSDYFVGWSAMLSVVSIYDSTRGYAVLGAIREAYHKSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTGNPSLCGAPLEEPCGREEDEEATKQEQDEDKEEEDQVFSWIAAEIGYVPGLFCGLAIGHILTSYKLDW

superfamily: SSF52058
2-430 SSF52058,LRR

SSLSKLEAFDIDGNSFSGTIPSSLFMIPSLDRLNLGRNHFSGPLEIGNISSQSNLQILYIGENNFDGPIPRSISKLVGLSELSLSFWNTRRSIVDFSIFLHLKSLESLDLSYLNTRSMVEFSLFSPLMSLGYLDLSGISLKFSSTLHLPSSLIEYLILTSCNISEFPTFLQNQTSLEYLDISANQIEGQLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSPGDSLSFPKLRIFDISENRFTGVLPSDYFVGWSAMLSVVSIYDSTRGYAVLGAIREAYHKSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTGNP

Gene3D: G3DSA:3.80.10.10
2-144 G3DSA:3.80.10.10

SSLSKLEAFDIDGNSFSGTIPSSLFMIPSLDRLNLGRNHFSGPLEIGNISSQSNLQILYIGENNFDGPIPRSISKLVGLSELSLSFWNTRRSIVDFSIFLHLKSLESLDLSYLNTRSMVEFSLFSPLMSLGYLDLSGISLKFS

ProfileScan: PS51450
IPR001611
30-51 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLDRLNLGRNHFSGPLEIGNIS

ProfileScan: PS51450
IPR001611
105-126 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLESLDLSYLNTRSMVEFSLFS

Gene3D: G3DSA:3.80.10.10
154-285 G3DSA:3.80.10.10

IEYLILTSCNISEFPTFLQNQTSLEYLDISANQIEGQLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSPGDSLSFPKLRIFDISENRFTGVLPSDYFVGWSAMLSVVS

HMMPfam: PF12799
175-217 LRR_4,Leucine Rich repeats (2 copies)

TSLEYLDISANQIEGQLSGQLPKSLIKCTDLEFLNVEDNRIND

ProfileScan: PS51450
IPR001611
176-198 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLDISANQIEGQLSGQLPKS

FPrintScan: PR00019
177-190 LEURICHRPT,Leucine-rich repeat signature

LEYLDISANQIEGQ

ProfileScan: PS51450
IPR001611
204-225 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLEFLNVEDNRINDKFPFWLRS

ProfileScan: PS51450
IPR001611
254-275 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRIFDISENRFTGVLPSDYFV

HMMPfam: PF00560
IPR001611
254-274 LRR_1
Leucine-rich repeat

KLRIFDISENRFTGVLPSDYF

HMMPfam: PF13855
327-384 LRR_8,Leucine rich repeat

KTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRL

Gene3D: G3DSA:3.80.10.10
329-438 G3DSA:3.80.10.10

IDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTGNPSLCGAPLE

ProfileScan: PS51450
IPR001611
349-372 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELIVLNMSNNAFTGHIPPSLSNLS

FPrintScan: PR00019
371-384 LEURICHRPT,Leucine-rich repeat signature

LSNLQSLDLSQNRL

ProfileScan: PS51450
IPR001611
373-395 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLDLSQNRLSGSIPGELGEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox