PRGDB00048564 (AT4g14050)

From PRG Wiki
Jump to: navigation, search
AT4g14050
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7268064 (AL161537)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 37.

DNA Sequence

ATGATAACAGTAAAATGGAGCTTGTGTTTAATCTTCTGCCTTTCAAACTCAATACTTGTTTTTGCTAAACACTTGTGTCTTCCAGACCAGAGGGATTCTCTTTGGGGGTTCAAGAACGAATTCCATGTCCCAAGCGAGAAGTGGAGGAACAACACTGATTGCTGTTCTTGGGATGGTGTTTCTTGTGATCCTAAGACGGGCAATGTCGTTGGGTTAGATCTAGCGGGCAGTGATCTCAATGGCCCTTTGAGATCTAATAGCAGCCTGTTTAGACTACAACATCTTCAGAAGCTGTATCTTGGTTGTAATACTTCATTCGGAAGTCTTTCTTATAATGATGGTTTGAAGGGTGGTGAGCTACTGGATTCCATCGGCAACCTCAAATATTTGAAGGTTTTGAGTCTTCGTGGTTGCAATCTCTTTGGAAAGATTCCTTCTTCACTCGGAAATCTTTCTTATCTCACTCATCTTGATCTTTCTTTTAATGATTTCACCGGTGTGATACCAGATTCGATGGGCAATCTCAACTATTTGAGGGTTTTGAATCTTGGTAAATGCAATTTCTATGGAAAGGTTCCTTCTTCACTCGGAAATCTTTCTTATCTCGCTCAACTTGATCTTTCCTATAATGATTTCACCCGTGAAGGACCAGATTCAATGGGGAACCTTAACCGACTAACCGATATGCTTCTCAAGTTGAACTCGCTCACCGATATCGACCTTGGTTCTAACCAGTTGAAAGGTATGCTCCCATCTAACATGAGTAGCCTCTCCAAACTGGAGTATTTTTATATTGGTGGAAATTCATTTTCTGGATCCATTCCCTCTTCTCTCTTCATGATCCCTTCGTTGGTTGAACTTGACCTGCAAAGAAACCACTTCAGCGCTCTTGAGATTGGGAATATCTCTTCACAATCTAAACTTCAAGTATTAATTCTTGGAGGAAATAATTTCAATCCGGACATTGTTGATTTGAGTATTTTCTCACCTCTCTTGTCACTTGGTTATTTGGATGTTTCAGGGATTAATTTGAAGATCAGTTCAACCGTCAGTCTTCCCTCACCCATAGAATACTTGGTTTTATCGTCGTGTAATATTTCCGAGTTTCCCAAATTTCTACGTAACCAAACCAAGTTGTATTCTTTAGACATCTCTGCCAATCAAATTGAAGGCCAAGTACCGGAGTGGTTATGGAGTCTGCCAGAGTTGCAGTCTATTAACATCTCTCATAATTCTTTCAATGGTTTCGAAGGACCAGCAGATGTTATTCAAGGAGGTGGAGAACTATATATGCTTGACATAAGTTCAAACATATTCCAGGATCCATTTCCTTTGTTACCAGTAGACTCTATGAATTTCTTGTTCAGCTCCAATAATCGATTTTCGGGAGAGATTCCTAAAACAATATGCGAATTGGATAATCTTGTGATGCTTGTTTTGTCAAACAACAACTTCAGCGGTTCTATTCCTCGGTGTTTTGAGAATTTACATCTTTATGTCTTGCATCTTCGGAATAACAACCTCTCTGGTATTTTTCCAGAGGAAGCTATCAGTGATCGCTTGCAATCACTTGATGTTGGTCACAATCTTTTCTCAGGAGAACTTCCCAAATCATTGATCAACTGCAGTGCACTCGAGTTTCTATACGTGGAAGATAACCGAATCAGTGACACGTTTCCATCCTGGTTGGAATTGTTGCCCAATTTTCAGATTCTTGTCCTTCGTTCTAACGAGTTCTATGGGCCAATATTTTCTCCTGGAGATTCTTTGAGTTTCCCCAGGTTGCGAATCTTTGATATTTCGGAAAATCGCTTCACTGGAGTCTTGCCATCAGATTACTTTGCGCCTTGGAGTGCAATGTCGTCAGTCGTGGATAGAATAATTCAGCATTTTTTCCAGGGATACTATCATAACTCTGTGGTTCTGACGAACAAAGGATTAAATATGGAGCTGGTTGGGAGTGGTTTCACAATCTACAAAACCATTGATGTCTCCGGAAACAGACTCGAAGGAGACATCCCCGAGTCCATCAGTCTTCTCAAGGAACTGATTGTGCTCAACATGTCAAACAACGCTTTCACAGGCCATATTCCACCATCTCTATCAAACTTGAGCAATCTCCAATCATTGGATCTATCTCAAAACAGATTATCCGGCAGTATCCCAGGAGAGCTCGGGGAACTCACATTTCTAGCGCGGATGAACTTCTCTTACAACAGGCTTGAAGGTCCAATACCACAAACCACTCAGATTCAAACCCAGGATAGTTCTTCTTTCACAGAGAATCCTGGACTCTGTGGTCTTCCTCTAAAAAAAAACTGCGGCGGAAAAGAAGAAGCAACAAAGCAAGAGCAAGATGAGGAAAAGGAAGAAGAAGAACAAGTATTTAGCTGGATCGCAGCTGCAATAGGCTACGTACCTGGTGTTGTGTGTGGACTCACCATCGGCCACATTCTGGTTTCACACAAACGTGACTGGTTCATGAGAATTGTTTCCCTCTTTACTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MITVKWSLCLIFCLSNSILVFAKHLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQRNHFSALEIGNISSQSKLQVLILGGNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNCGGKEEATKQEQDEEKEEEEQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFMRIVSLFT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF911
1-828 PTHR24420:SF911

MITVKWSLCLIFCLSNSILVFAKHLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQRNHFSALEIGNISSQSKLQVLILGGNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNCGGKEEATKQEQDEEKEEEEQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFM

HMMPanther: PTHR24420
1-828 PTHR24420,FAMILY NOT NAMED

MITVKWSLCLIFCLSNSILVFAKHLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQRNHFSALEIGNISSQSKLQVLILGGNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNCGGKEEATKQEQDEEKEEEEQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFM

Gene3D: G3DSA:3.80.10.10
26-233 G3DSA:3.80.10.10

CLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKL

HMMPfam: PF08263
IPR013210
28-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCD

superfamily: SSF52047
71-414 SSF52047,LRR

GLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQRNHFSALEIGNISSQSKLQVLILGGNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFN

ProfileScan: PS51450
IPR001611
94-116 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQKLYLGCNTSFGSLSYNDGLK

HMMPfam: PF13855
129-187 LRR_8,Leucine rich repeat

YLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCN

ProfileScan: PS51450
IPR001611
153-175 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTHLDLSFNDFTGVIPDSMGNL

FPrintScan: PR00019
154-167 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSFNDFTGV

HMMPfam: PF13516
202-222 LRR_6,Leucine Rich repeat

LAQLDLSYNDFTREGPDSMGN

Gene3D: G3DSA:3.80.10.10
234-345 G3DSA:3.80.10.10

NSLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQRNHFSALEIGNISSQSKLQVLILGGNNFNPDIVDLSIFSPLLSLGYLDVSGINLK

HMMPfam: PF13855
235-294 LRR_8,Leucine rich repeat

SLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQRNHF

ProfileScan: PS51450
IPR001611
235-256 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDIDLGSNQLKGMLPSNMSS

ProfileScan: PS51450
IPR001611
283-306 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVELDLQRNHFSALEIGNISSQS

ProfileScan: PS51450
IPR001611
307-329 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLILGGNNFNPDIVDLSIFS

ProfileScan: PS51450
IPR001611
355-376 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

PIEYLVLSSCNISEFPKFLRNQ

HMMPfam: PF13855
356-412 LRR_8,Leucine rich repeat

IEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNS

Gene3D: G3DSA:3.80.10.10
356-515 G3DSA:3.80.10.10

IEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEE

ProfileScan: PS51450
IPR001611
378-401 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYSLDISANQIEGQVPEWLWSLP

ProfileScan: PS51450
IPR001611
402-423 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQSINISHNSFNGFEGPADVI

superfamily: SSF52058
430-513 SSF52058,LRR

YMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFP

ProfileScan: PS51450
IPR001611
474-496 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVMLVLSNNNFSGSIPRCFENL

HMMPfam: PF00560
IPR001611
474-496 LRR_1
Leucine-rich repeat

NLVMLVLSNNNFSGSIPRCFENL

ProfileScan: PS51450
IPR001611
497-518 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLYVLHLRNNNLSGIFPEEAIS

ProfileScan: PS51450
IPR001611
520-543 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQSLDVGHNLFSGELPKSLINCS

superfamily: SSF52058
520-774 SSF52058,LRR

RLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNC

Gene3D: G3DSA:3.80.10.10
520-622 G3DSA:3.80.10.10

RLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSS

ProfileScan: PS51450
IPR001611
544-566 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALEFLYVEDNRISDTFPSWLELL

ProfileScan: PS51450
IPR001611
658-680 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

IYKTIDVSGNRLEGDIPESISLL

HMMPfam: PF13855
660-717 LRR_8,Leucine rich repeat

KTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRL

Gene3D: G3DSA:3.80.10.10
662-771 G3DSA:3.80.10.10

IDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLK

ProfileScan: PS51450
IPR001611
682-705 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELIVLNMSNNAFTGHIPPSLSNLS

FPrintScan: PR00019
704-717 LEURICHRPT,Leucine-rich repeat signature

LSNLQSLDLSQNRL

ProfileScan: PS51450
IPR001611
706-728 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLDLSQNRLSGSIPGELGEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox