PRGDB00048565 (AT4g14050)

From PRG Wiki
Jump to: navigation, search
AT4g14050
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7268064 (AL161537)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 37.

DNA Sequence

ATGAAGTGTGAAAAGGCAACAGAGACGTGGAGGAACAAGACTGATTGCTGTTCTTGGAATCGTGTCTCTTGTGATCCTAAGACAGGCAAGGTCGTCGAGTTAGATCTCATGAGCAGTTGTCTCAATGGCCCTTTGAGATCTAATAGTAGCCTGTTTAGACTACAACATCTCCAGAGCTTAGAACTTAGCTCCAATAATATTTCCGGTATCCTACCAGATTCCATCGGCAACCTCAAATATTTGAGGTCTTTAAGTTTTCGTACTTGCCATCTCTTTGGAAAGATTCCATCTTCACTCGGAAGTCTTTCTTATCTCACTCATCTTGATCTTTCTTATAACGATTTCACCAGTGAAGGACCAGATTCGGGTGGCAACCTAAACCGACTTACAGATTTGCAACTTGTGCTACTCAACTTGAGCTCGGTCACCTGGATCGACCTTGGTTCTAACCAGTTGAAAGGAAGGGGCATTGTTGATTTCAGCATCTTCTTGCATCTCAAGTCACTTTGTTCACTTGACCTCTCCTATCTGAATACAAGAAGCATGGTTGATTTGAGTTTTTTTTCACATCTCATGTCACTTGATGAGCTGGATCTTTCAGGGATTAATTTGAAGATCAGTTCAACTCTCAGCTTTCCCTCAGCCACGGGCACCTTGATTTTAGCATCCTGCAATATTGTTGAGTTCCCCAAGTTTCTAGAAAACCAAACCAGTTTGTTTTATCTAGACATCTCTGCAAATCACATTGAAGGCCAAGTACCGGAGTGGTTGTGGAGACTGCCAACGTTGTCGTTTGTAAACATTGCTCAGAATTCCTTCAGTGGAGAACTACCTATGTTACCAAACTCTATCTATAGCTTTATAGCCTCTGATAATCAGTTTTCGGGAGAGATTCCTAGAACAGTATGCGAATTGGTTAGTCTTAATACACTTGTTTTATCTAACAACAAATTCAGCGGTTCTATTCCCCGGTGTTTTGAGAATTTCAAAACTATTTCAATCTTGCATCTTCGGAATAACAGCCTCTCGGGTGTTTTTCCAAAGGAAATTATCAGTGAAACCTTGACATCACTTGATGTTGGTCACAATTGGCTATCAGGACAACTTCCCAAGTCTCTGATCAAATGCACTGACCTCGAGTTTCTGAACGTGGAAGATAACAGAATCAATGACAAATTTCCATTTTGGTTGAGATCGTTGTCCAATCTACAGATTCTTGTCCTTCGTTCTAATGAGTTCTATGGGCCAATATTTTCTCTTGAAGATTCTTTGAGTTTCCCCAAGTTGCGAATCTTTGATATTTCGGAAAATCACTTCACTGGAGTCTTGCCATCAGATTACTTTGCAGGTTGGAGTGCAATGTCATCAGTCGTAGACATTTTTGATACTACGCCTCAGGTTCACATTTTAGGAGTTTTCCAGGGATACTATCATAACTCTGTGGTTCTGACGAACAAAGGATTAAATATGGAGCTGGTTGGGAGTGGTTTCACAATCTACAAAACCATTGATGTCTCCGGAAACAGACTCGAAGGAGATATTCCAGAATCGATTGGTATACTCAAGGAACTGATTGTGCTCAACATGTCAAACAACGCTTTCACAGGCCATATTCCACCATCTCTATCAAACTTGAGCAATCTCCAATCATTGGATCTATCTCAAAACAGATTATCCGGCAGTATCCCGCCAGAGCTCGGGAAACTTACGTTTCTGGAGTGGATGAACTTCTCGTACAACAGGCTTGAAGGTCCAATACCACAAGCCACTCAGATTCAAAGCCAGAATAGTTCTTCTTTCGCAGAGAATCCCGGGCTTTGCGGTGCTCCTTTCCTAAACAAATGTGGTGGAGAAGAAGAAGAAGAAGAAGAAGCAACAAAGCAAGAAGAAGATGAAGATGAAGAAAAGGAAGAGAAAAATCAAGTATTTAGCTGGATAGCAGCTGCAATAGGATATGTACCTGGTGTGTTCTGTGGACTCACCATCGCCCACATTCTCACTTCATAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKCEKATETWRNKTDCCSWNRVSCDPKTGKVVELDLMSSCLNGPLRSNSSLFRLQHLQSLELSSNNISGILPDSIGNLKYLRSLSFRTCHLFGKIPSSLGSLSYLTHLDLSYNDFTSEGPDSGGNLNRLTDLQLVLLNLSSVTWIDLGSNQLKGRGIVDFSIFLHLKSLCSLDLSYLNTRSMVDLSFFSHLMSLDELDLSGINLKISSTLSFPSATGTLILASCNIVEFPKFLENQTSLFYLDISANHIEGQVPEWLWRLPTLSFVNIAQNSFSGELPMLPNSIYSFIASDNQFSGEIPRTVCELVSLNTLVLSNNKFSGSIPRCFENFKTISILHLRNNSLSGVFPKEIISETLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSLEDSLSFPKLRIFDISENHFTGVLPSDYFAGWSAMSSVVDIFDTTPQVHILGVFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQATQIQSQNSSSFAENPGLCGAPFLNKCGGEEEEEEEATKQEEDEDEEKEEKNQVFSWIAAAIGYVPGVFCGLTIAHILTS


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
6-135 G3DSA:3.80.10.10

ATETWRNKTDCCSWNRVSCDPKTGKVVELDLMSSCLNGPLRSNSSLFRLQHLQSLELSSNNISGILPDSIGNLKYLRSLSFRTCHLFGKIPSSLGSLSYLTHLDLSYNDFTSEGPDSGGNLNRLTDLQLV

HMMPanther: PTHR24420:SF913
10-666 PTHR24420:SF913

WRNKTDCCSWNRVSCDPKTGKVVELDLMSSCLNGPLRSNSSLFRLQHLQSLELSSNNISGILPDSIGNLKYLRSLSFRTCHLFGKIPSSLGSLSYLTHLDLSYNDFTSEGPDSGGNLNRLTDLQLVLLNLSSVTWIDLGSNQLKGRGIVDFSIFLHLKSLCSLDLSYLNTRSMVDLSFFSHLMSLDELDLSGINLKISSTLSFPSATGTLILASCNIVEFPKFLENQTSLFYLDISANHIEGQVPEWLWRLPTLSFVNIAQNSFSGELPMLPNSIYSFIASDNQFSGEIPRTVCELVSLNTLVLSNNKFSGSIPRCFENFKTISILHLRNNSLSGVFPKEIISETLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSLEDSLSFPKLRIFDISENHFTGVLPSDYFAGWSAMSSVVDIFDTTPQVHILGVFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQATQIQSQNSSSFAENPGLCGAPFLNKCGGEEEEEEEATKQEEDEDEEKEEKNQVFSWIAAAIGYVPGVFCGLTIAHIL

HMMPanther: PTHR24420
10-666 PTHR24420,FAMILY NOT NAMED

WRNKTDCCSWNRVSCDPKTGKVVELDLMSSCLNGPLRSNSSLFRLQHLQSLELSSNNISGILPDSIGNLKYLRSLSFRTCHLFGKIPSSLGSLSYLTHLDLSYNDFTSEGPDSGGNLNRLTDLQLVLLNLSSVTWIDLGSNQLKGRGIVDFSIFLHLKSLCSLDLSYLNTRSMVDLSFFSHLMSLDELDLSGINLKISSTLSFPSATGTLILASCNIVEFPKFLENQTSLFYLDISANHIEGQVPEWLWRLPTLSFVNIAQNSFSGELPMLPNSIYSFIASDNQFSGEIPRTVCELVSLNTLVLSNNKFSGSIPRCFENFKTISILHLRNNSLSGVFPKEIISETLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSLEDSLSFPKLRIFDISENHFTGVLPSDYFAGWSAMSSVVDIFDTTPQVHILGVFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQATQIQSQNSSSFAENPGLCGAPFLNKCGGEEEEEEEATKQEEDEDEEKEEKNQVFSWIAAAIGYVPGVFCGLTIAHIL

superfamily: SSF52047
28-274 SSF52047,LRR

TGKVVELDLMSSCLNGPLRSNSSLFRLQHLQSLELSSNNISGILPDSIGNLKYLRSLSFRTCHLFGKIPSSLGSLSYLTHLDLSYNDFTSEGPDSGGNLNRLTDLQLVLLNLSSVTWIDLGSNQLKGRGIVDFSIFLHLKSLCSLDLSYLNTRSMVDLSFFSHLMSLDELDLSGINLKISSTLSFPSATGTLILASCNIVEFPKFLENQTSLFYLDISANHIEGQVPEWLWRLPTLSFVNIAQNSFS

HMMPfam: PF00560
IPR001611
56-78 LRR_1
Leucine-rich repeat

HLQSLELSSNNISGILPDSIGNL

ProfileScan: PS51450
IPR001611
56-79 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQSLELSSNNISGILPDSIGNLK

FPrintScan: PR00019
57-70 LEURICHRPT,Leucine-rich repeat signature

LQSLELSSNNISGI

HMMPfam: PF13516
103-120 LRR_6,Leucine Rich repeat

SYLTHLDLSYNDFTSEGP

ProfileScan: PS51450
IPR001611
104-125 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTHLDLSYNDFTSEGPDSGGN

Gene3D: G3DSA:3.80.10.10
137-350 G3DSA:3.80.10.10

LNLSSVTWIDLGSNQLKGRGIVDFSIFLHLKSLCSLDLSYLNTRSMVDLSFFSHLMSLDELDLSGINLKISSTLSFPSATGTLILASCNIVEFPKFLENQTSLFYLDISANHIEGQVPEWLWRLPTLSFVNIAQNSFSGELPMLPNSIYSFIASDNQFSGEIPRTVCELVSLNTLVLSNNKFSGSIPRCFENFKTISILHLRNNSLSGVFPKEI

ProfileScan: PS51450
IPR001611
168-189 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLCSLDLSYLNTRSMVDLSFFS

ProfileScan: PS51450
IPR001611
193-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLDELDLSGINLKISSTLSFPS

HMMPfam: PF13855
218-272 LRR_8,Leucine rich repeat

TLILASCNIVEFPKFLENQTSLFYLDISANHIEGQVPEWLWRLPTLSFVNIAQNS

ProfileScan: PS51450
IPR001611
238-261 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLFYLDISANHIEGQVPEWLWRLP

superfamily: SSF52058
280-603 SSF52058,LRR

LPNSIYSFIASDNQFSGEIPRTVCELVSLNTLVLSNNKFSGSIPRCFENFKTISILHLRNNSLSGVFPKEIISETLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSLEDSLSFPKLRIFDISENHFTGVLPSDYFAGWSAMSSVVDIFDTTPQVHILGVFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQATQIQSQNSSSFAEN

HMMPfam: PF00560
IPR001611
307-328 LRR_1
Leucine-rich repeat

SLNTLVLSNNKFSGSIPRCFEN

ProfileScan: PS51450
IPR001611
307-329 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLNTLVLSNNKFSGSIPRCFENF

ProfileScan: PS51450
IPR001611
354-377 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLTSLDVGHNWLSGQLPKSLIKCT

Gene3D: G3DSA:3.80.10.10
354-456 G3DSA:3.80.10.10

TLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEFYGPIFSLEDSLSFPKLRIFDISENHFTGVLPSDYFAGWSAMSS

ProfileScan: PS51450
IPR001611
378-399 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLEFLNVEDNRINDKFPFWLRS

HMMPfam: PF00560
IPR001611
428-450 LRR_1
Leucine-rich repeat

KLRIFDISENHFTGVLPSDYFAG

HMMPfam: PF13855
501-558 LRR_8,Leucine rich repeat

KTIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRL

Gene3D: G3DSA:3.80.10.10
503-610 G3DSA:3.80.10.10

IDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQATQIQSQNSSSFAENPGLCGAP

ProfileScan: PS51450
IPR001611
523-546 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELIVLNMSNNAFTGHIPPSLSNLS

FPrintScan: PR00019
545-558 LEURICHRPT,Leucine-rich repeat signature

LSNLQSLDLSQNRL

ProfileScan: PS51450
IPR001611
547-570 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLDLSQNRLSGSIPPELGKLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox