PRGDB00048567 (AT4g14050)

From PRG Wiki
Jump to: navigation, search
AT4g14050
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7268064 (AL161537)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 37.

DNA Sequence

ATGACTGAGAAGTGGAGGAACAACACTGATTGCTGTTCCTGGGATGGTGTCTCTTGTGATCCCAAGACGGGAGTGGTGGTTGAGTTAGACCTCCAGTATAGTCATCTCAATGGTCCTTTGAGATCTAATAGTAGCCTGTTTAGACTACAACATCTTCAGAAGCTAGTTCTTGGCAGCAATCATCTTTCGGGTATTCTACCGGATTCCATAGGCAATCTCAAACGTTTGAAGGTTTTGGTTCTTGTTAATTGCAATCTTTTTGGAAAGATTCCTTCTTCACTCGGAAATCTTTCTTATCTCACTCATCTTGATCTTTCCTATAATGATTTCACCAGTGAAGGACCAGATTCAATGGGGAACCTTAACCGACTAACCGATATGCTTCTCAAGTTGAGCTCGGTCACCTGGATCGACCTTGGTGATAACCAGTTGAAAGGTATGCTCCCATCTAACATGAGTAGCCTCTCCAAACTGGAGGCTTTTGATATTAGTGGAAATTCATTTTCTGGAACCATTCCCTCTTCTCTCTTCATGATCCCTTCGTTGATTCTACTTCACCTGGGAAGAAACGACTTCAGCGGTCCTTTTGAGATTGGGAATATCTCTTCACCATCTAATCTTCAACTATTAAACATTGGAAGAAACAATTTCAATCCGGACATTGTTGATTTGAGTATTTTCTCACCTCTCTTGTCACTTGGTTATTTGGATGTTTCAGGGATTAATTTGAAGATCAGTTCAACCGTCAGTCTTCCCTCACCCATAGAATACTTGGGTCTATTGTCGTGCAATATTTCCGAGTTTCCCAAATTTCTACGTAACCAAACCAGTTTGGAGTATTTAGACATCTCTGCCAATCAAATTGAAGGCCAAGTACCGGAGTGGTTATGGAGTCTGCCAGAGTTGCGGTATGTTAACATTTCTCATAATTCTTTCAATGGTTTCGAAGGACCAGCAGATGTTATTCAAGGAGGTCGAGAATTACTTGTGCTTGACATAAGTTCAAACATATTCCAGGATCCATTTCCTTTGTTACCAGTAGTCTCTATGAATTACTTGTTCAGCTCCAATAATCGATTCTCGGGAGAGATTCCTAAAACAATATGCGAATTGGATAATCTTCGGATACTTGTTTTGTCAAACAACAACTTCAGCGGTTCTATTCCTCGGTGTTTTGAGAATTTACATCTTTATGTCTTGCACCTTCGGAATAACAACCTCTCTGGTATTTTTCCAGAGGAAGCTATCAGTCATCACTTGCAATCATTTGATGTTGGTCACAATCTTTTCTCAGGAGAACTTCCCAAATCATTGATCAACTGCAGTGATATCGAGTTTCTAAACGTGGAAGATAACAGAATCAATGACACGTTTCCATCCTGGTTGGAATTGTTGCCCAATCTTCAGATTCTTGTCCTTCGTTCTAACGAGTTCTATGGGCCAATATTTTCTCCTGGAGATTCTTTAAGTTTCTCCAGGTTGCGAATCTTTGATATTTCGGAAAATCGCTTCACTGGAGTTTTGCCGTCAGATTACTTTGTTGGTTGGAGTGTAATGTCATCAGTCGTGGACATTGATGGTAGAATAATTCAGTATACAGTTACAGGAATTGACCGGGACTTCTACCATAAGTCTGTAGCTCTCATAAACAAAGGATTAAAGATGGAGCTGGTTGGGAGTGGTTTCACAATCTACAAAACCATCGATGTCTCGGGAAACAGACTCGAAGGAGACATCCCCGAGTCCATCGGTCTTCTCAAAGAAGTGATTGTGCTCAGCATGTCAAACAACGCTTTCACAGGCCATATTCCACCATCTCTATCAAACTTGAGCAATCTCCAATCATTGGATCTTTCTCAAAACAGATTATCCGGCAGTATCCCAGGAGAGCTCGGAAAACTCACGTTTCTAGAGTGGATGAACTTCTCGCACAACAGGCTTGAAGGTCCAATACCAGAAACCACTCAGATTCAAACCCAAGATAGTTCTTCTTTCACAGAGAATCCCGGGCTTTGCGGTGCTCCTCTCCTAAAAAAATGTGGTGGAGAAGAAGAAGCAACAAAGCAAGAACAAGATGAAGACAAGGAAGAGGAAGATCAAGTATTTAGCTGGATAGCAGCTGCAATAGGCTACGTACCTGGTGTTGTGTGTGGACTCACCATCGGCCACATTCTGGTTTCACACAAACGTGACTGGTTCATGAGAATTGTTTCCTTCTTTACTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MTEKWRNNTDCCSWDGVSCDPKTGVVVELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNHLSGILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGPDSMGNLNRLTDMLLKLSSVTWIDLGDNQLKGMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMIPSLILLHLGRNDFSGPFEIGNISSPSNLQLLNIGRNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLGLLSCNISEFPKFLRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHNSFNGFEGPADVIQGGRELLVLDISSNIFQDPFPLLPVVSMNYLFSSNNRFSGEIPKTICELDNLRILVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISHHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTFPSWLELLPNLQILVLRSNEFYGPIFSPGDSLSFSRLRIFDISENRFTGVLPSDYFVGWSVMSSVVDIDGRIIQYTVTGIDRDFYHKSVALINKGLKMELVGSGFTIYKTIDVSGNRLEGDIPESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHNRLEGPIPETTQIQTQDSSSFTENPGLCGAPLLKKCGGEEEATKQEQDEDKEEEDQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFMRIVSFFT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
2-734 PTHR24420,FAMILY NOT NAMED

TEKWRNNTDCCSWDGVSCDPKTGVVVELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNHLSGILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGPDSMGNLNRLTDMLLKLSSVTWIDLGDNQLKGMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMIPSLILLHLGRNDFSGPFEIGNISSPSNLQLLNIGRNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLGLLSCNISEFPKFLRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHNSFNGFEGPADVIQGGRELLVLDISSNIFQDPFPLLPVVSMNYLFSSNNRFSGEIPKTICELDNLRILVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISHHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTFPSWLELLPNLQILVLRSNEFYGPIFSPGDSLSFSRLRIFDISENRFTGVLPSDYFVGWSVMSSVVDIDGRIIQYTVTGIDRDFYHKSVALINKGLKMELVGSGFTIYKTIDVSGNRLEGDIPESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHNRLEGPIPETTQIQTQDSSSFTENPGLCGAPLLKKCGGEEEATKQEQDEDKEEEDQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFM

HMMPanther: PTHR24420:SF911
2-734 PTHR24420:SF911

TEKWRNNTDCCSWDGVSCDPKTGVVVELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNHLSGILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGPDSMGNLNRLTDMLLKLSSVTWIDLGDNQLKGMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMIPSLILLHLGRNDFSGPFEIGNISSPSNLQLLNIGRNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLGLLSCNISEFPKFLRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHNSFNGFEGPADVIQGGRELLVLDISSNIFQDPFPLLPVVSMNYLFSSNNRFSGEIPKTICELDNLRILVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISHHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTFPSWLELLPNLQILVLRSNEFYGPIFSPGDSLSFSRLRIFDISENRFTGVLPSDYFVGWSVMSSVVDIDGRIIQYTVTGIDRDFYHKSVALINKGLKMELVGSGFTIYKTIDVSGNRLEGDIPESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHNRLEGPIPETTQIQTQDSSSFTENPGLCGAPLLKKCGGEEEATKQEQDEDKEEEDQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFM

HMMPfam: PF08263
IPR013210
2-20 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TEKWRNNTDCCSWDGVSCD

Gene3D: G3DSA:3.80.10.10
5-243 G3DSA:3.80.10.10

WRNNTDCCSWDGVSCDPKTGVVVELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNHLSGILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGPDSMGNLNRLTDMLLKLSSVTWIDLGDNQLKGMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMIPSLILLHLGRNDFSGPFEIGNISSPSNLQLLNIGRNNFNPDIVDLSIFSPLLSLGYLDVSGINL

superfamily: SSF52047
28-340 SSF52047,LRR

ELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNHLSGILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGPDSMGNLNRLTDMLLKLSSVTWIDLGDNQLKGMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMIPSLILLHLGRNDFSGPFEIGNISSPSNLQLLNIGRNNFNPDIVDLSIFSPLLSLGYLDVSGINLKISSTVSLPSPIEYLGLLSCNISEFPKFLRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHNSFNGFEGPADVIQGGRELLVLDISSNIFQD

ProfileScan: PS51450
IPR001611
51-74 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQKLVLGSNHLSGILPDSIGNLK

HMMPfam: PF13516
98-120 LRR_6,Leucine Rich repeat

SYLTHLDLSYNDFTSEGPDSMGN

ProfileScan: PS51450
IPR001611
99-120 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTHLDLSYNDFTSEGPDSMGN

ProfileScan: PS51450
IPR001611
157-179 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEAFDISGNSFSGTIPSSLFMI

HMMPfam: PF00560
IPR001611
157-177 LRR_1
Leucine-rich repeat

KLEAFDISGNSFSGTIPSSLF

ProfileScan: PS51450
IPR001611
206-228 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQLLNIGRNNFNPDIVDLSIFS

Gene3D: G3DSA:3.80.10.10
255-414 G3DSA:3.80.10.10

IEYLGLLSCNISEFPKFLRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHNSFNGFEGPADVIQGGRELLVLDISSNIFQDPFPLLPVVSMNYLFSSNNRFSGEIPKTICELDNLRILVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEE

HMMPfam: PF13855
257-311 LRR_8,Leucine rich repeat

YLGLLSCNISEFPKFLRNQTSLEYLDISANQIEGQVPEWLWSLPELRYVNISHNS

ProfileScan: PS51450
IPR001611
277-300 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLDISANQIEGQVPEWLWSLP

FPrintScan: PR00019
278-291 LEURICHRPT,Leucine-rich repeat signature

LEYLDISANQIEGQ

ProfileScan: PS51450
IPR001611
301-322 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRYVNISHNSFNGFEGPADVI

ProfileScan: PS51450
IPR001611
327-348 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELLVLDISSNIFQDPFPLLPVV

superfamily: SSF52058
329-412 SSF52058,LRR

LVLDISSNIFQDPFPLLPVVSMNYLFSSNNRFSGEIPKTICELDNLRILVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFP

HMMPfam: PF00560
IPR001611
373-395 LRR_1
Leucine-rich repeat

NLRILVLSNNNFSGSIPRCFENL

ProfileScan: PS51450
IPR001611
373-395 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRILVLSNNNFSGSIPRCFENL

ProfileScan: PS51450
IPR001611
396-417 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLYVLHLRNNNLSGIFPEEAIS

superfamily: SSF52058
418-680 SSF52058,LRR

HHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTFPSWLELLPNLQILVLRSNEFYGPIFSPGDSLSFSRLRIFDISENRFTGVLPSDYFVGWSVMSSVVDIDGRIIQYTVTGIDRDFYHKSVALINKGLKMELVGSGFTIYKTIDVSGNRLEGDIPESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHNRLEGPIPETTQIQTQDSSSFTENPGLCGAPLLKKC

Gene3D: G3DSA:3.80.10.10
418-520 G3DSA:3.80.10.10

HHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTFPSWLELLPNLQILVLRSNEFYGPIFSPGDSLSFSRLRIFDISENRFTGVLPSDYFVGWSVMS

ProfileScan: PS51450
IPR001611
443-465 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIEFLNVEDNRINDTFPSWLELL

ProfileScan: PS51450
IPR001611
564-586 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

IYKTIDVSGNRLEGDIPESIGLL

Gene3D: G3DSA:3.80.10.10
568-677 G3DSA:3.80.10.10

IDVSGNRLEGDIPESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHNRLEGPIPETTQIQTQDSSSFTENPGLCGAPLL

HMMPfam: PF12799
591-624 LRR_4,Leucine Rich repeats (2 copies)

VLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLS

FPrintScan: PR00019
610-623 LEURICHRPT,Leucine-rich repeat signature

LSNLQSLDLSQNRL

ProfileScan: PS51450
IPR001611
612-635 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLDLSQNRLSGSIPGELGKLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox