PRGDB00048568 (AT4g04290)

From PRG Wiki
Jump to: navigation, search
AT4g04290
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267152 (AL161499)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 11.

DNA Sequence

ATGTCGAAGCAATGTCTTCTCTCCTGCTTCCTCTTCTTCTGCTTCTTCATACCACAACTATCTTTCTCTTGTCCACAAGATCAAAGACAATCCCTTCTCGAGTTCAAGAACTTGCTGATTCACAACATCAAGGACAACTACACAGCCTTTGAAGAATTAGGGACATGGAGGCCAAACTCAGATTGCTGCAAATGGCTACGCGTGACATGTAACGCTAGTTCGCCTTCCAAAGAAGTGATAGACCTGAATCTATTCTTGCTCATCCCCCCTGGCTTAGTTAGTTCAAGCATTTTGAGACCGATTCTGCGTATAAACTCTCTTGTTGGGCTTGATGTCTCATTTAACAACATACAAGGAGAGATTCCTGGATATGCGTTTGTGAACTTGACCAGCTTGATTTCTCTTGACATGTGTTGTAATAGATTTAACGGCTCAATTCCTCATGAATTGTTCTCCTTGACAAATCTTCAGCGTCTTGATTTAAGCAGGAATGTTATTGGCGGTACGTTGAGTGGTGACATCAAAGAGCTCAAGAATCTGCAGGAACTGATCTTAGATGAGAATCTCATTGGAGGAGCGATTCCTTCAGAAATAGATGATATTGGAAACTTGGTCAATCTATCAACTCTGTCCTTGAGCATGAACAAGTTGTCGGGTGGAATTCCATCGTCGATTCATAATCTGAAAAATCTTGAAACCCTTCAGCTTGAGAATAACAATGGCTTGTCAGGTGAGATTCCCGCAGCTTGGTTGTTTGGTCTTCAGAAGCTGAAGGTACTACGGCTTGAAGGAAACAACAAACTCCAATGGAACAATAATGGTTATGTCTTTCCACAGTTTAAGTTAACACATCTGTCACTTAGATCTTGTGGCTTAGAAGGGAATATTCCGGATTGGCTCAAGAATCAAACAGCTCTTGTTTACTTGGATTTGAGCATTAACAGACTCGAAGGAAGATTCCCAAAATGGCTAGCTGATCTGAAAATCAGAAACATAACTTTGTCAGACAACAGACTCACAGGCTCACTGCCTCCAAATTTGTTTCAGCGTCCGAGCTTATACTATCTTGTACTATCAAGGAACAACTTTTCTGGTCAGATCCCTGATACGATTGGCGAATCACAGGTCATGGTACTCATGTTGTCTGAAAACAACTTCTCAGGATCAGTACCAAAGTCTATTACAAAGATCCCCTTTCTCAAGTTGTTGGACTTGTCAAAGAATCGATTATCAGGTGAATTCCCGAGGTTCCGCCCCGAGTCATACCTTGAGTGGCTCGATATATCTTCGAACGAGTTCTCTGGGGATGTTCCAGCTTACTTTGGAGGATCCACCAGTATGCTCTTAATGAGTCAGAACAATTTCAGCGGCGAATTTCCTCAGAACTTCAGAAATCTTTCATATCTGATCCGTCTTGATCTCCATGACAACAAAATCTCTGGAACAGTCGCGAGTTTAATCTCCCAGTTATCTTCTTCTGTAGAGGTTCTTAGCCTGAGAAACAATTCCCTCAAAGGTTCAATCCCAGAAGGCATATCAAATCTCACAAGCCTTAAGGTCTTGGATCTCTCTGAGAACAATCTTGATGGATATCTCCCTTCATCTCTTGGGAATCTTACATGCATGATAAAATCTCCTGAGCCCTCAGCTATGACTATCCGTCCCTATTTCAGCTCCTATACCGACATACCCAACATAGAAAGATTAATCGAGATCGAATCAGAAGATATATTTAGTCTTGTAGTGAACTGGAAGAATTCAAAACAAGTTCTTTTCGACAGAAACTTCTACCTCTACACTCTCTTAGATCTCTCCAAGAACAAGCTACACGGAGAAATCCCAACTTCTTTAGGCAATCTCAAAAGCCTAAAGGTTTTAAATCTTTCCAACAACGAGTTCTCTGGATTGATCCCACAAAGTTTTGGAGATCTTGAGAAGGTAGAGAGCTTAGACCTTTCACACAACAACCTCACTGGCGAAATCCCGAAAACGTTATCCAAGCTAAGCGAGCTGAATACATTGGATTTGCGTAACAACAAGCTTAAAGGTAGAATCCCTGAAAGTCCTCAGCTAGACAGATTGAACAATCCAAACATTTACGCGAACAACAGCGGAATCTGTGGAATGCAAATCCAAGTACCATGCTTTCCTACACAGACCAAGCAGCCAGCTGAGGAAAAAGAAGAAGAAGACAAAGAAGAAGAAGAAACAATTTTTTCATGGAATGCAGCAGCCATAGGTTGCTCTTGTGGATTCCTTATAGCAGTTGTGTTCATGTCTTACAATGAGTTATGGAAGTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MSKQCLLSCFLFFCFFIPQLSFSCPQDQRQSLLEFKNLLIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCNASSPSKEVIDLNLFLLIPPGLVSSSILRPILRINSLVGLDVSFNNIQGEIPGYAFVNLTSLISLDMCCNRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLIGGAIPSEIDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNGYVFPQFKLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGRFPKWLADLKIRNITLSDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIPDTIGESQVMVLMLSENNFSGSVPKSITKIPFLKLLDLSKNRLSGEFPRFRPESYLEWLDISSNEFSGDVPAYFGGSTSMLLMSQNNFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQLSSSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTCMIKSPEPSAMTIRPYFSSYTDIPNIERLIEIESEDIFSLVVNWKNSKQVLFDRNFYLYTLLDLSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNNKLKGRIPESPQLDRLNNPNIYANNSGICGMQIQVPCFPTQTKQPAEEKEEEDKEEEETIFSWNAAAIGCSCGFLIAVVFMSYNELWK


Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-24 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MSKQCLLSCFLFFCFFIPQLSFSC

HMMPanther: PTHR24420:SF473
10-708 PTHR24420:SF473,SUBFAMILY NOT NAMED

FLFFCFFIPQLSFSCPQDQRQSLLEFKNLLIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCNASSPSKEVIDLNLFLLIPPGLVSSSILRPILRINSLVGLDVSFNNIQGEIPGYAFVNLTSLISLDMCCNRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLIGGAIPSEIDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNGYVFPQFKLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGRFPKWLADLKIRNITLSDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIPDTIGESQVMVLMLSENNFSGSVPKSITKIPFLKLLDLSKNRLSGEFPRFRPESYLEWLDISSNEFSGDVPAYFGGSTSMLLMSQNNFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQLSSSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTCMIKSPEPSAMTIRPYFSSYTDIPNIERLIEIESEDIFSLVVNWKNSKQVLFDRNFYLYTLLDLSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNNKLKGRIPESPQLDRLNNPNIYANNSGICG

HMMPanther: PTHR24420
10-708 PTHR24420,FAMILY NOT NAMED

FLFFCFFIPQLSFSCPQDQRQSLLEFKNLLIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCNASSPSKEVIDLNLFLLIPPGLVSSSILRPILRINSLVGLDVSFNNIQGEIPGYAFVNLTSLISLDMCCNRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLIGGAIPSEIDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNGYVFPQFKLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGRFPKWLADLKIRNITLSDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIPDTIGESQVMVLMLSENNFSGSVPKSITKIPFLKLLDLSKNRLSGEFPRFRPESYLEWLDISSNEFSGDVPAYFGGSTSMLLMSQNNFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQLSSSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTCMIKSPEPSAMTIRPYFSSYTDIPNIERLIEIESEDIFSLVVNWKNSKQVLFDRNFYLYTLLDLSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNNKLKGRIPESPQLDRLNNPNIYANNSGICG

Gene3D: G3DSA:3.80.10.10
24-266 G3DSA:3.80.10.10

CPQDQRQSLLEFKNLLIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCNASSPSKEVIDLNLFLLIPPGLVSSSILRPILRINSLVGLDVSFNNIQGEIPGYAFVNLTSLISLDMCCNRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLIGGAIPSEIDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNN

HMMPfam: PF08263
IPR013210
25-71 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PQDQRQSLLEFKNLLIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCN

superfamily: SSF52058
39-368 SSF52058,LRR

LIHNIKDNYTAFEELGTWRPNSDCCKWLRVTCNASSPSKEVIDLNLFLLIPPGLVSSSILRPILRINSLVGLDVSFNNIQGEIPGYAFVNLTSLISLDMCCNRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLIGGAIPSEIDDIGNLVNLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNNKLQWNNNGYVFPQFKLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGRFPKWLADLKIRNITLSDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIP

HMMPfam: PF13855
131-190 LRR_8,Leucine rich repeat

SLISLDMCCNRFNGSIPHELFSLTNLQRLDLSRNVIGGTLSGDIKELKNLQELILDENLI

HMMPfam: PF13855
206-266 LRR_8,Leucine rich repeat

NLSTLSLSMNKLSGGIPSSIHNLKNLETLQLENNNGLSGEIPAAWLFGLQKLKVLRLEGNN

Gene3D: G3DSA:3.80.10.10
281-429 G3DSA:3.80.10.10

KLTHLSLRSCGLEGNIPDWLKNQTALVYLDLSINRLEGRFPKWLADLKIRNITLSDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIPDTIGESQVMVLMLSENNFSGSVPKSITKIPFLKLLDLSKNRLSGEFPRFRPESYLEWLDIS

HMMPfam: PF00560
IPR001611
281-302 LRR_1
Leucine-rich repeat

KLTHLSLRSCGLEGNIPDWLKN

HMMPfam: PF00560
IPR001611
329-349 LRR_1
Leucine-rich repeat

IRNITLSDNRLTGSLPPNLFQ

superfamily: SSF52047
331-749 SSF52047,LRR

NITLSDNRLTGSLPPNLFQRPSLYYLVLSRNNFSGQIPDTIGESQVMVLMLSENNFSGSVPKSITKIPFLKLLDLSKNRLSGEFPRFRPESYLEWLDISSNEFSGDVPAYFGGSTSMLLMSQNNFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQLSSSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTCMIKSPEPSAMTIRPYFSSYTDIPNIERLIEIESEDIFSLVVNWKNSKQVLFDRNFYLYTLLDLSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNNKLKGRIPESPQLDRLNNPNIYANNSGICGMQIQVPCFPTQTKQPAEEKEEEDKEEEETIFSWNAAAIGCS

FPrintScan: PR00019
400-413 LEURICHRPT,Leucine-rich repeat signature

LKLLDLSKNRLSGE

Gene3D: G3DSA:3.80.10.10
430-544 G3DSA:3.80.10.10

SNEFSGDVPAYFGGSTSMLLMSQNNFSGEFPQNFRNLSYLIRLDLHDNKISGTVASLISQLSSSVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTCMIK

HMMPfam: PF12799
493-529 LRR_4,Leucine Rich repeats (2 copies)

SVEVLSLRNNSLKGSIPEGISNLTSLKVLDLSENNLD

FPrintScan: PR00019
515-528 LEURICHRPT,Leucine-rich repeat signature

LTSLKVLDLSENNL

HMMPfam: PF13855
601-657 LRR_8,Leucine rich repeat

LLDLSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNL

Gene3D: G3DSA:3.80.10.10
602-703 G3DSA:3.80.10.10

LDLSKNKLHGEIPTSLGNLKSLKVLNLSNNEFSGLIPQSFGDLEKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNNKLKGRIPESPQLDRLNNPNIYANN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox