PRGDB00048570 (RPS4-Ler)

From PRG Wiki
Jump to: navigation, search
RPS4-Ler
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5823586 (AJ249264)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RPS4-Ler gene for disease resistance protein, ecotype Landsberg erecta.

DNA Sequence

ATGGAGACATCATCTATTTCCACTGTGGAAGACAAGCCACCGCAGCATCAGGTGTTCATCAATTTCCGTGGGGCAGATTTGCGCCGGAGATTCGTCAGCCATCTCGTAACGGCCTTGAAATTGAACAACATCAACGTCTTTATCGACGACTATGAAGACAGAGGTCAACCTCTAGATGTACTGCTGAAGAGGATAGAGGAGTCCAAAATCGTTTTGGCTATCTTCTCCGGCAACTACACCGAGTCAGTCTGGTGCGTGAGAGAGCTGGAGAAGATCAAAGATTGTACGGATGAAGGAACACTCGTTGCGATTCCAATCTTCTACAAGCTGGAGCCATCCACCGTTAGAGATTTGAAAGGAAAGTTCGGTGATAGATTTAGGAGTATGGCTAAGGGTGATGAGAGGAAAAAGAAATGGAAGGAAGCTTTTAACTTGATTCCTAACATTATGGGCATCATCATTGACAAGAAAAGTGTGGAGAGTGAGAAAGTCAATGAAATTGTGAAGGCGGTGAAGACAGCGTTGACCGGAATACCACCGGAGGGAAGTCACAACGCCGTCGTGGGTGCTTTAGGTAATAGCAACGCTGGAACTTCCTCAGGAGACAAAAAGCATGAGACTTTTGGAAACGAACAACGGTTAAAAGATTTGGAAGAGAAGTTGGATCGTGATAAATACAAGGGAACTCGTATCATTGGAGTTGTTGGGATGCCCGGAATTGGTAAAACCACACTCCTGAAAGAGCTATATAAGACGTGGCAGGGCAAGTTTTCGAGGCATGCGCTAATCGATCAAATCCGTGTAAAGTCCAAGCACTTGGAGTTGGATCGCTTGCCTCAAATGCTCTTAGGCGAGTTGTCCAAGTTAAACAATCCTCACGTAGACAATCTCAAAGATCCATACAGTCAACTGCATGAACGCAAAGTGCTTGTTGTACTTGATGATGTTAGTAAAAGGGAACAAATAGATGCTCTTCGTGAGATACTAGACTGGATTAAGGAGGGTAAGGAGGGAAGCAGGGTTGTCATTGCAACAAGCGACATGTCCTTAACAAATGGTTTGGTTGATGATACTTACATGGTTCAAAATTTGAACCACAGAGATAGCTTACAACTATTTCACTATCATGCCTTTATTGATGATCAAGCCAATCCTCAAAAGAAAGATTTCATGAAGCTGTCAGAAGGGTTTGTACATTACGCCAGAGGCCATCCACTAGCCCTCAAAGTATTGGGTGGAGAGCTTAATAAGAAAAGTATGGATCATTGGAATTCGAAAATGAAGAAACTTGCACAGAGCCCCAGCCCTAATATTGTCAGTGTCTTCCAAGTGAGTTATGATGAATTGACTACAGCGCAGAAAGATGCATTTCTCGACATAGCCTGTTTCAGATCACAGGACAAGGATTATGTAGAAAGTCTACTGGCTTCATCTGACCTTGGTTCGGCTGAAGCAATGAGTGCAGTCAAATCTCTCACGGATAAGTTCCTGATTAATACTTGTGATGGCCGAGTGGAGATGCATGATCTATTATATAAATTTTCAAGGGAAGTTGATCTGAAGGCATCTAATCAGGATGGTAGCAGACAACGGAGGCTGTGGCTCCATCAACACATAATCAAGGGAGGCATAATCAATGTATTGCAAAATAAAATGAAAGCTGCCAATGTTAGAGGTATTTTCCTAGACTTGTCTGAAGTGGAAGACGAAACGAGCTTAGACCGCGACCACTTCATAAATATGGGAAATCTCCGGTATCTCAAGTTCTACAATTCCCATTGTCCACAGGAATGTAAAACCAACAATAAAATCAACATCCCTGATAAACTTAAGCTACCATTGAAAGAAGTTCGATGCCTCCACTGGCTGAAATTCCCATTGGAGACACTTCCAAACGATTTCAACCCAATTAATCTTGTCGACCTTAAGCTGCCCTACAGTGAAACGGAACAACTTTGGGAGGGTGACAAGGACACACCATGCTTAAGGTGGGTCGATCTCAATCACTCAAGTAAGTTGTGCAGCTTGTCAGGGTTATCAAAAGCTGAAAAGCTTCAAAGGTTGAACCTTGAAGGTTGCACAACACTGAAAGCGTTTCCACATGATATGAAAAAAATGAAAATGCTTGCTTTCTTGAATCTGAAGGGGTGTACAAGTCTCGAATCTCTTCCAGAGATGAATTTGATTTCTCTGAAAACACTTACTCTCAGCGGCTGCTCAACTTTTAAGGAATTTCCGTTGATTTCAGATAATATAGAAACTCTATACTTAGATGGCACAGCAATAAGTCAGCTTCCTATGAACATGGAGAAGCTTCAGAGACTTGTTGTATTGAATATGAAAGACTGCAAAATGCTAGAGGAAATTCCAGGCCGTGTTGGTGAGCTGAAAGCTCTTCAAGAACTGATACTCTCTGATTGTTTAAATCTCAAGATTTTCCCAGAAATCGACATTAGCTTTTTAAACATTTTACTTTTGGATGGGACAGCCATTGAAGTGATGCCACAATTACCCTCAGTGCAGTATTTGTGCTTAAGCAGAAATGCTAAGATCAGCTGCCTTCCTGTTGGAATCAGTCAGCTTTCTCAACTTAAATGGCTGGACCTGAAGTATTGTACGAGTCTTACATCAGTTCCAGAGTTTCCACCAAATCTTCAGTGCTTAGATGCACACGGCTGTAGTTCGCTGAAGACAGTTTCAAAGCCTTTGGCCCGTATCATGCCAACTGAACAGAATCATTCCACATTCATTTTCACCAACTGTGAGAACCTGGAACAAGCTGCAAAGGAGGAAATCACATCGTATGCTCAAAGGAAATGCCAGCTGTTATCATATGCTCGGAAACGCTACAATGGGGGTCTTGTTTCAGAATCTTTGTTCAGCACTTGCTTTCCTGGATGTGAAGTGCCTTCTTGGTTTTGTCATGAAACAGTTGGATCTGAGTTAGAAGTAAAACTCCTCCCACATTGGCATGACAAGAAGCTTGCCGGGATTGCTCTATGTGCTGTAATCTCATGTCTTGACCCCCAAGATCAAGTCAGCCGCTTGTCAGTGACCTGCACCTTTAAAGTAAAAGATGAAGACAAGTCTTGGGTCCCATATACTTGTCCAGTAGGAAGTTGGACCAGACATGGAGGCGGGAAAGATAAGATTGAGCTAGACCATGTCTTCATTGGATACACCAGTTGCCCACATACTATAAAATGTCATGAAGAAGGTAACTCAGATGAATGCAATCCTACCGAAGCCTCTCTTAAATTTACTGTGACAGGAGGTACAAGTGAGAATGGAAAATACAAGGTGTTTAAGTGTGGTTTAAGTTTGGTGTATGCTAAGGATAAAGACAAAAATAGTGCTCTTGAAACAAAGTACGATATGCTTATTGGAAAGAGCTTTCAAGAAACTTCAGAAGGGGTTGATGGAAGGGTAAAGAAAACGAAAGGAAAGTACGTTATGCCTGTTGAAAAGAACTTTCAAGAAACTACAGAAGGGGTTGATGGAAGAGTAAAGAAAAAGAAAAAAACAAGAATGGATAATGGACGGCCAAAGAAGAAGCAGAGATCAGGAAGAGATGATAATCAAACTAGGATGCAAGTGGAACTCCAAGAAGGAAATATAAATTCAGTGATCATGCACACGGTTAAGAATTTCTGA


Protein sequences

Name Description Sequence
disease resistance protein RPS4-Ler disease resistance protein RPS4-Ler [Arabidopsis thaliana].

METSSISTVEDKPPQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNNPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSETEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRKCQLLSYARKRYNGGLVSESLFSTCFPGCEVPSWFCHETVGSELEVKLLPHWHDKKLAGIALCAVISCLDPQDQVSRLSVTCTFKVKDEDKSWVPYTCPVGSWTRHGGGKDKIELDHVFIGYTSCPHTIKCHEEGNSDECNPTEASLKFTVTGGTSENGKYKVFKCGLSLVYAKDKDKNSALETKYDMLIGKSFQETSEGVDGRVKKTKGKYVMPVEKNFQETTEGVDGRVKKKKKTRMDNGRPKKKQRSGRDDNQTRMQVELQEGNINSVIMHTVKNF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSISTVEDKPPQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGI

Gene3D: G3DSA:3.40.50.10140
14-141 G3DSA:3.40.50.10140

PQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKE

ProfileScan: PS50104
IPR000157
14-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNI

HMMSmart: SM00255
IPR000157
15-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNI

HMMPfam: PF01582
IPR000157
18-142 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEA

HMMPanther: PTHR23155:SF48
25-939 PTHR23155:SF48,SUBFAMILY NOT NAMED

ADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNNPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSETEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRK

HMMPanther: PTHR23155
25-939 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALTGIPPEGSHNAVVGALGNSNAGTSSGDKKHETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNNPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKAANVRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSETEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRK

superfamily: SSF52540
205-438 SSF52540

HETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNNPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNI

Gene3D: G3DSA:3.40.50.300
205-356 G3DSA:3.40.50.300

HETFGNEQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNNPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVD

HMMPfam: PF00931
IPR002182
211-472 NB-ARC,NBS
NB-ARC

EQRLKDLEEKLDRDKYKGTRIIGVVGMPGIGKTTLLKELYKTWQGKFSRHALIDQIRVKSKHLELDRLPQMLLGELSKLNNPHVDNLKDPYSQLHERKVLVVLDDVSKREQIDALREILDWIKEGKEGSRVVIATSDMSLTNGLVDDTYMVQNLNHRDSLQLFHYHAFIDDQANPQKKDFMKLSEGFVHYARGHPLALKVLGGELNKKSMDHWNSKMKKLAQSPSPNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVE

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

IIGVVGMPGIGKTTLL

FPrintScan: PR00364
IPR000767
303-317 DISEASERSIST
Disease resistance protein

QLHERKVLVVLDDVS

FPrintScan: PR00364
IPR000767
401-415 DISEASERSIST
Disease resistance protein

ARGHPLALKVLGGEL

superfamily: SSF46785
436-540 SSF46785

PNIVSVFQVSYDELTTAQKDAFLDIACFRSQDKDYVESLLASSDLGSAEAMSAVKSLTDKFLINTCDGRVEMHDLLYKFSREVDLKASNQDGSRQRRLWLHQHII

superfamily: SSF52058
569-940 SSF52058,LRR

DETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLKLPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSETEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGCSSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAKEEITSYAQRKC

Gene3D: G3DSA:3.80.10.10
619-810 G3DSA:3.80.10.10

CLHWLKFPLETLPNDFNPINLVDLKLPYSETEQLWEGDKDTPCLRWVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLVVLNMKDCKMLEEIPGRVGELKALQELILSDCLNL

HMMPfam: PF07725
IPR011713
638-657 LRR_3
Leucine-rich repeat 3

NLVDLKLPYSETEQLWEGDK

Gene3D: G3DSA:3.80.10.10
826-893 G3DSA:3.80.10.10

LDGTAIEVMPQLPSVQYLCLSRNAKISCLPVGISQLSQLKWLDLKYCTSLTSVPEFPPNLQCLDAHGC

FPrintScan: PR00364
IPR000767
859-875 DISEASERSIST
Disease resistance protein

SQLSQLKWLDLKYCTSL


List of References

W Gassmann, M E Hinsch, B J Staskawicz
The Arabidopsis RPS4 bacterial-resistance gene is a member of the TIR-NBS-LRR family of disease-resistance genes.
Plant J.: 1999, 20(3);265-77
PubMed:10571887 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox