PRGDB00048577 (F18A5.300)

From PRG Wiki
Jump to: navigation, search
F18A5.300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5748493 (AL035528)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, BAC clone F18A5 (ESSA project).

DNA Sequence

CACAAATGAACTTCTCCTACAACATGCTTGAAGGTCCAATTCCACAAGGCACTCAGATTCAAAGCCAGAATAGTTCTTCATTCGCAGAGAATCTCGGGCTCTGCGGTGTTCCTCTCCAAGAAACTTGCGGGGGAGAAGAAGAAGAAGAAAAAGAAGCAACAAAGCAAGAGCAAGATGAAGAAAAAGATCAAGTATTGAGCTGGATCGCAGCTGCAATAGGCTACGTACCTGGTGTTGTGTGTGGACTCACCATTGGTCACATTCTCACTTCGTATAAACGTGACTGGTTCATGAAAAGCTTTCAGTATTTTGCTTAAAAAACCAAACCACTTTGTATTATTTAGACATCTCTGCCAATAAAATTGGAGGCCAAGTACCACAATGGTTGTGGAGTCTACCGGAGTTGCAGTATGTTAACATTTCTCAAAATTCTTTCAGTGGCTTTGAAGGACCAGCAGATGTTATTCAAAGATGTGGAGAATTACTTATGCTTGACATAAGTTCAAACACATTCCAAGATCCGTTTCCTTTGTTACCAAACTCGACAACGATCTTTTTAGGCTCTGATAATCGGTTTTCGGGAGAGATTCCTAAGACTATATGCAAATTGGTTTCTCTTGATACACTTGTTTTATCCAACAACAACTTCAACGGCTCCATTCCTCGGTGTTTCGAGAAGTTTAATACTACTCTTTCGGTTTTGCATCTTCGGAATAACAACTTATCCGGTGAGTTTCCAGAGGAATCTATCAGTGATCACTTGAGATCACTTGACGTTGGTCGCAACCGGTTATCAGGAGAACTTCCCAAGTCTTTGATCAACTGCACTCGTCTCGAGTTTCTGAACGTGGAAGACAACATAATCAATGACAAGTTTCCATTCTGGTTGAGAATGTTGCCCAAACTTCAGATTTTTGTCCTTCGTTCTAACGAGTTTCATGGTCCAATATCTTCTCTTGGAGATTCTTTGAGCTTCCCCAAGCTGCGAATCTTTGACATTTCGGAAAACCGCTTCAATGGAGTCCTTCGATCAGATTTCTTTGCGGGTTGGAGTGCAATGTCATCAGCCGTAGACATCGTAGATATTATGCCGAGTAGGTATGCTGGACGTGACTCAGGAAACTATTATAACTCAGTGACTATGACGGTCAAAGGATCGATAATAGAGTTGGTTGGGAGTGTTTTCACGATTTACAAAACCATCGATGTCTCCGGAAACAGATTCGAAGGACGTATTCCCGAGTCAATCGGTTTACTTAAAGAACTGATTGTGCTCAATATGTCAAACAACGATGACAATATGGAGCTTGTGTTTAATCTTGTCCCTTTCTAATTCAAAACTGGTTTTGGCTTCTCATGTTAAGCACTTATGTCGTCAAGACCAGAAGAATGCTCTTTTGGAGTTTAAGAACGAGTTTTATGTCCATGAGTTCAACTCCAATGGGATTGTTGGTGTTAAGAAGACAGAGAAGTGGAGGAACAACACCGATTGCTGTTCTTGGGATGGTATCTCTTGTGATCCTAAAACGGGTAAGGTGGTAGAGTTAGACCTCATGAACAGTTTTCTTAATGGTCCTTTGAGATATGATAGTAGCTTGTTTAGACTACAACATCTTCATAATCTGGATCTTGGCTCGAATAATTTTTCGGGTATTCTACCGGATTCCATAGGCAGCCTCAAATATTTGAGGGTTTTGAGTCTTGGTGATTGTAATCTCTTTGGAAAGATTCCTTCTTCACTTGGAAATCTTACTTATCTCACTAATCTTGATCTTTCTGTTAATGATTTCACCGGGGAGCTACCGGATTCGATGGGACATTTAAACAAGCTAACAGAGTTGCATCTTGGATCGGCCAAGCTCAGTGGGAACTTTCCTAGTATGCTACTCAATTTGAGCGAGCTTACGTTGATCGACCTTGGTTCTAACCAGTTCGGAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNAQMNFSYNMLEGPIPQGTQIQSQNSSSFAENLGLCGVPLQETCGGEEEEEKEATKQEQDEEKDQVLSWIAAAIGYVPGVVCGLTIGHILTSYKRDWFMKSFQYFA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-641 PTHR24420,FAMILY NOT NAMED

MTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNAQMNFSYNMLEGPIPQGTQIQSQNSSSFAENLGLCGVPLQETCGGEEEEEKEATKQEQDEEKDQVLSWIAAAIGYVPGVVCGLTIGHILTSYKRDWFMKSF

HMMPanther: PTHR24420:SF911
1-641 PTHR24420:SF911

MTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNAQMNFSYNMLEGPIPQGTQIQSQNSSSFAENLGLCGVPLQETCGGEEEEEKEATKQEQDEEKDQVLSWIAAAIGYVPGVVCGLTIGHILTSYKRDWFMKSF

superfamily: SSF52058
25-258 SSF52058,LRR

HLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGF

Gene3D: G3DSA:3.80.10.10
27-286 G3DSA:3.80.10.10

CRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFP

HMMPfam: PF08263
IPR013210
29-76 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCD

HMMPfam: PF00560
IPR001611
107-129 LRR_1
Leucine-rich repeat

HLHNLDLGSNNFSGILPDSIGSL

HMMPfam: PF00560
IPR001611
132-153 LRR_1
Leucine-rich repeat

LRVLSLGDCNLFGKIPSSLGNL

HMMPfam: PF13504
154-171 LRR_7,Leucine rich repeat

TYLTNLDLSVNDFTGELP

superfamily: SSF52047
219-599 SSF52047,LRR

TTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNAQMNFSYNMLEGPIPQGTQIQSQNSSSFAENLGLCGVPLQETCGGEEEEEKEATKQEQD

Gene3D: G3DSA:3.80.10.10
289-465 G3DSA:3.80.10.10

PNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSS

HMMPfam: PF00560
IPR001611
341-360 LRR_1
Leucine-rich repeat

LSVLHLRNNNLSGEFPEESI

HMMPfam: PF00560
IPR001611
363-384 LRR_1
Leucine-rich repeat

HLRSLDVGRNRLSGELPKSLIN

Gene3D: G3DSA:3.80.10.10
511-583 G3DSA:3.80.10.10

IDVSGNRFEGRIPESIGLLKELIVLNMSNNAQMNFSYNMLEGPIPQGTQIQSQNSSSFAENLGLCGVPLQETC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox