PRGDB00048579 (T19K4.270)

From PRG Wiki
Jump to: navigation, search
T19K4.270
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3036791 (AL022373)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, BAC clone T19K4 (ESSAII project).

DNA Sequence

ATGACTAAACCATTTTCGTCCTCGGGTTACCTGCAGGAGATTTTTGATAATGAAGTTGAGGAATTGAGGGTTATCTATGATGGCTTAGACGAGAATGATAGAAATTTATTACTTTACATGGCATATCTGAATGGCGAGGAAGCTGATTTCTTGGCACCCCTTATAGCTAGCACTGGCTTGGGGATTAGTTCTAGGCTCAATGTCTTAGCCAATAAGTCTCTCATAAACATATCTCCGTATGGTATCATAGTACGGCAAGGTTTACTTAAGAAAATAGGTAGGGAGATAGTCTATAGAAGTGTTTACTTAAGCAGCCTCAACGACACTCTGCCTGGTAGCTCAACAGTGTCGTTGAGGCTGGCTGCGGTTAAAGAGCCTAAAGTTACAACGTTTAAAGTCCCGAGAGTTAGAAGTGTGAAACAAGATGAATTTAATGCTAAAATTAATGCCTTTATCAGCCGATTTAAGCAAAAACCTCAATAG


Protein sequences

Name Description Sequence
putative disease resistance protein (fragment) putative disease resistance protein (fragment) [Arabidopsis thaliana].

MTKPFSSSGYLQEIFDNEVEELRVIYDGLDENDRNLLLYMAYLNGEEADFLAPLIASTGLGISSRLNVLANKSLINISPYGIIVRQGLLKKIGREIVYRSVYLSSLNDTLPGSSTVSLRLAAVKEPKVTTFKVPRVRSVKQDEFNAKINAFISRFKQKPQ







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox