PRGDB00048583 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22218098 (AF315083)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Brassica rapa subsp. oleifera

Comment?

Brassica rapa subsp. oleifera clone RGA42 putative disease resistance protein gene, partial cds.

DNA Sequence

TCTTCTCACACAGATCAACGATAAGTTTCGCGAGACAGTTGATGGTGTCCAGATTGTCATTTGGGTTGTGGTGTCCAGTGATCTACGGGTCGAAAAGATTCAAGATGATATTGCTAAGAAGTTAGGCCTTCGCGGAGAGGAGTGGAACCAGAAAGAGAAAATAGAAAAGGTCGCTGATATACACGCTCGTATGCAGAATAAGAGATTTGTCTTGTTATTAGATGACATTTGGAGGAAAGTGGATTTAACAGAAATTGGAGTCCCATCTCCGACAAGAGAAAACGGATGCAAAGTAGTATTCACCACTCGTTCCAGGGAAGTATGTGGTCGCATGGGGGTTGATGATCCAATGGAAGTCCAGTGTCTAACAAACAAAGAAGCATGGAACTTGTTCGAGAAAAAGGTCGGACCACTCACGTTAAAAAGCCACCCAGGCATTCCTGAACAAGCAAGAAAAGTTGCTGAAAAATGTCGT


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Brassica rapa subsp. oleifera].

LLTQINDKFRETVDGVQIVIWVVVSSDLRVEKIQDDIAKKLGLRGEEWNQKEKIEKVADIHARMQNKRFVLLLDDIWRKVDLTEIGVPSPTRENGCKVVFTTRSREVCGRMGVDDPMEVQCLTNKEAWNLFEKKVGPLTLKSHPGIPEQARKVAEKCR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-95 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLTQINDKFRETVDGVQIVIWVVVSSDLRVEKIQDDIAKKLGLRGEEWNQKEKIEKVADIHARMQNKRFVLLLDDIWRKVDLTEIGVPSPTRENG

HMMPanther: PTHR23155:SF111
1-95 PTHR23155:SF111,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LLTQINDKFRETVDGVQIVIWVVVSSDLRVEKIQDDIAKKLGLRGEEWNQKEKIEKVADIHARMQNKRFVLLLDDIWRKVDLTEIGVPSPTRENG

HMMPfam: PF00931
IPR002182
2-158 NB-ARC,NBS
NB-ARC

LTQINDKFRETVDGVQIVIWVVVSSDLRVEKIQDDIAKKLGLRGEEWNQKEKIEKVADIHARMQNKRFVLLLDDIWRKVDLTEIGVPSPTRENGCKVVFTTRSREVCGRMGVDDPMEVQCLTNKEAWNLFEKKVGPLTLKSHPGIPEQARKVAEKCR

Gene3D: G3DSA:3.40.50.300
17-104 G3DSA:3.40.50.300

QIVIWVVVSSDLRVEKIQDDIAKKLGLRGEEWNQKEKIEKVADIHARMQNKRFVLLLDDIWRKVDLTEIGVPSPTRENGCKVVFTTRS

superfamily: SSF52540
19-154 SSF52540

VIWVVVSSDLRVEKIQDDIAKKLGLRGEEWNQKEKIEKVADIHARMQNKRFVLLLDDIWRKVDLTEIGVPSPTRENGCKVVFTTRSREVCGRMGVDDPMEVQCLTNKEAWNLFEKKVGPLTLKSHPGIPEQARKVA


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox