PRGDB00048585 (Disease resistance protein RGA3, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA3, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32470628 (AY303170)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum chromosome 8 clone UW3A14, complete sequence.

DNA Sequence

GTTTTGTTTTAACTGAGCCAAAAGTTTATGGAAGGGAAAAAGAGGAGGATGAGATAGTGAAAATCTTGATAAACAATGTTAGTTATTCCGAAGAAGTTCCAGTACTCCCAATACTTGGTATGGGGGGACTAGGAAAGACGACTCTAGCCCAAATGGTCTTCAATGATCAAAGAATTACTGAGCATTTCAATCTAAAGATATGGGTTTGTGTCTCAGATGATTTTGATGAGAAGAGGTTGATTAAGGCAATTGTAGAATCTATTGAAGGAAAGTCACTGGGTGACATGGACTTGGCTCCCCTCCAGAAAAAGCTTCAGGAGTTGTTGAATGGAAAAAGATACTTTCTTGTTTTGGATGATGTTTGGAATGAAGATCAAGAAAAGTGGGATAATCTTAGAGCAGTATTGAAGATTGGAGCTAGTGGTGCTTCAATTCTAATTACTACTCGTCTTGAAAAAATTGGATCAATTATGGGAACTTTGCAACTATATCAGTTATCAAATTTGTCTCAAGAAGATTGTTGGTTGTTGTTCAAGCAACGTGCATTTTGCCACCAAACCGAAACAAGTCCTAAACTTATGGAAATCGGAAAGGAGATTGTGAAGAAATGTGGGGGTGTGCCTCTAGCAGCCAAAACTCTTGGAGGCCTTTTACGCTTCAAGAGGGAAGAAAGTGAATGGGAACATGTGAGAGATAGTGAGATTTGGAATTTACCTCAAGATGAAAATTCTGTTTTGCCTGCCCTGAGGCTGAGTTATCATCATCTTCCACTTGATTTGAGACAATGTTTTGCATATTGCGCAGTATTCCCAAAGGACACCAAAATAGAAAAGGAATATCTCATCGCTCTCTGGATGGCACACAGTTTTCTTTTATCAAAAGGAAACATGGAGCTAGAGGATGTGGGCAATGAAGTATGGAATGAATTATACTTGAGGTCTTTTTTCCAAGAGATTGAAGTTAAATCTGGTAAAACTTATTTCAAGATGCATGATCTCATCCATGATTTGGCTACATCTATGTTTTCAGCAAGCGCATCAAGCAGAAGTATACGCCAAATAAATGTAAAAGATGATGAAGATATGATGTTCATTGTAACAAATTATAAAGATATGATGTCCATTGGTTTCTCCGAAGTGGTGTCTTCTTACTCTCCTTCGCTCTTTAAAAGGTTTGTCTCGTTAAGGGTGCTTAATCTAAGTAACTCAGAATTTGAACAGTTACCGTCTTCCGTTGGAGATCTAGTACATTTAAGATACCTTGACCTGTCTGGTAATAAAATTTGTAGTCTTCCAAAGAGGTTGTGCAAGCTTCAAAATCTGCAGACTCTTGATCTATATAATTGCCAGTCACTTTCTTGTTTGCCGAAACAAACAAGTAAGCTTTGTAGTCTCCGGAATCTTGTACTTGATCACTGTCCATTGACTTCTATGCCACCAAGAATAGGATTGTTGACATGCCTTAAGACACTAGGTTACTTTGTTGTAGGCGAGAGGAAAGGTTATCAACTTGGTGAACTACGAAATTTAAACCTCCGTGGTGCAATTTCAATCACACATCTTGAGAGAGTGAAAAATGATATGGAGGCAAAAGAAGCCAATTTATCTGCAAAAGCAAATCTACACTCTTTAAGCATGAGTTGGGATAGACCAAACAGATATGAATCCGAAGAAGTTAAAGTGCTTGAAGCCCTCAAACCACATCCCAATCTGAAATATTTAGAAATCATTGACTTCTGTGGATTCTGTCTCCCTGACTGGATGAATCACTCAGTTTTGAAAAATGTTGTCTCTATTCTAATTAGCGGTTGTGAAAACTGCTCGTGCTTACCACCCTTTGGTGAGCTGCCTTGTCTAGAAAGTCTGGAGTTACAAGACGGGTCTGTGGAGGTGGAGTATGTTGAAGATTCTGGATTCCTGACAAGAAGAAGATTTCCATCCCTGAGAAAACTTCATATAGGTGGCTTTTGTAATCTGAAAGGATTGCAGAGAATGAAAGGAGCAGAGCAATTCCCCGTGCTTGAAGAGATGAAGATTTCGGATTGCCCTATGTTTGTTTTTCCGACCCTTTCTTCTGTCAAGAAATTAGAAATTTGGGGGGAGGCAGATGCAGGAGGTTTGAGCTCCATATCTAATCTCAGCACTCTTACATCCCTCAAGATTTTCAGTAACCACACAGTGACTTCACTACTGGAAGAGATGTTCAAAAACCTTGAAAATCTCATATACTTGAGTGTCTCTTTCTTGGAGAATCTCAAAGAGCTGCCTACCAGCCTGGCTAGTCTCAACAATTTGAAGTGTCTGGATATTCGTTATTGTTACGCACTAGAGAGTCTCCCCGAGGAAGGGCTGGAAGGTTTATCTTCACTCACAGAGTTATTTGTTGAACACTGTAACATGCTAAAATGTTTACCAGAGGGATTGCAGCACCTAACAACCCTCACAAGTTTAAAAATTCGGGGATGTCCACAACTGATCAAGCGGTGTGAGAAGGGAATAGGAGAAGACTGGCACAAAATTTCTCACATTCCTAATGTGAATATATATATTTAAATGGCTGAAGCTTTCCTTCAAGTTCTGCTAGATAATCTCACTTTTTTCATCCAAGGGGAACTTGGATTGGTTTTTGGTTTCGAGAAGGAGTTTAAAAAACTTTCAAGTATGTTTTCAATGATCCAAGCTGTGCTAGAAGATGCTCAAGAGAAGCAACTGAAGTACAAGGCAATAAAGAACTGGTTACAGAAACTCAATGTTGCTGCATATGAAGTTGATGACATCTTGGATGACTGTAAAACTGAGGCAGCAAGATTCAAGCAGGCTGTATTGGGGCGTTATCATCCACGGACCATCACTTTCTGTTACAAGGTGGGAAAAAGAATGAAAGAAATGATGGAAAAACTAGATGCAATTGCAGAGGAACGGAGGAATTTTCATTTAGATGAAAGGATTATAGAGAGACAAGCTGCTAGACGGCAAACAG


Protein sequences

Name Description Sequence
Disease resistance protein RGA3, putative Disease resistance protein RGA3, putative [Solanum bulbocastanum].

MAEAFLQVLLDNLTFFIQGELGLVFGFEKEFKKLSSMFSMIQAVLEDAQEKQLKYKAIKNWLQKLNVAAYEVDDILDDCKTEAARFKQAVLGRYHPRTITFCYKVGKRMKEMMEKLDAIAEERRNFHLDERIIERQAARRQTGFVLTEPKVYGREKEEDEIVKILINNVSYSEEVPVLPILGMGGLGKTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKSLGDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTRLEKIGSIMGTLQLYQLSNLSQEDCWLLFKQRAFCHQTETSPKLMEIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDSEIWNLPQDENSVLPALRLSYHHLPLDLRQCFAYCAVFPKDTKIEKEYLIALWMAHSFLLSKGNMELEDVGNEVWNELYLRSFFQEIEVKSGKTYFKMHDLIHDLATSMFSASASSRSIRQINVKDDEDMMFIVTNYKDMMSIGFSEVVSSYSPSLFKRFVSLRVLNLSNSEFEQLPSSVGDLVHLRYLDLSGNKICSLPKRLCKLQNLQTLDLYNCQSLSCLPKQTSKLCSLRNLVLDHCPLTSMPPRIGLLTCLKTLGYFVVGERKGYQLGELRNLNLRGAISITHLERVKNDMEAKEANLSAKANLHSLSMSWDRPNRYESEEVKVLEALKPHPNLKYLEIIDFCGFCLPDWMNHSVLKNVVSILISGCENCSCLPPFGELPCLESLELQDGSVEVEYVEDSGFLTRRRFPSLRKLHIGGFCNLKGLQRMKGAEQFPVLEEMKISDCPMFVFPTLSSVKKLEIWGEADAGGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKNLENLIYLSVSFLENLKELPTSLASLNNLKCLDIRYCYALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHIPNVNIYI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
24-969 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VFGFEKEFKKLSSMFSMIQAVLEDAQEKQLKYKAIKNWLQKLNVAAYEVDDILDDCKTEAARFKQAVLGRYHPRTITFCYKVGKRMKEMMEKLDAIAEERRNFHLDERIIERQAARRQTGFVLTEPKVYGREKEEDEIVKILINNVSYSEEVPVLPILGMGGLGKTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKSLGDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTRLEKIGSIMGTLQLYQLSNLSQEDCWLLFKQRAFCHQTETSPKLMEIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDSEIWNLPQDENSVLPALRLSYHHLPLDLRQCFAYCAVFPKDTKIEKEYLIALWMAHSFLLSKGNMELEDVGNEVWNELYLRSFFQEIEVKSGKTYFKMHDLIHDLATSMFSASASSRSIRQINVKDDEDMMFIVTNYKDMMSIGFSEVVSSYSPSLFKRFVSLRVLNLSNSEFEQLPSSVGDLVHLRYLDLSGNKICSLPKRLCKLQNLQTLDLYNCQSLSCLPKQTSKLCSLRNLVLDHCPLTSMPPRIGLLTCLKTLGYFVVGERKGYQLGELRNLNLRGAISITHLERVKNDMEAKEANLSAKANLHSLSMSWDRPNRYESEEVKVLEALKPHPNLKYLEIIDFCGFCLPDWMNHSVLKNVVSILISGCENCSCLPPFGELPCLESLELQDGSVEVEYVEDSGFLTRRRFPSLRKLHIGGFCNLKGLQRMKGAEQFPVLEEMKISDCPMFVFPTLSSVKKLEIWGEADAGGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKNLENLIYLSVSFLENLKELPTSLASLNNLKCLDIRYCYALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIK

superfamily: SSF52540
134-383 SSF52540

ERQAARRQTGFVLTEPKVYGREKEEDEIVKILINNVSYSEEVPVLPILGMGGLGKTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKSLGDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTRLEKIGSIMGTLQLYQLSNLSQEDCWLLFKQRAFCHQTETSPKLMEIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDSEIWNLPQD

Gene3D: G3DSA:3.40.50.300
153-292 G3DSA:3.40.50.300

GREKEEDEIVKILINNVSYSEEVPVLPILGMGGLGKTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKSLGDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTR

HMMPfam: PF00931
IPR002182
158-433 NB-ARC,NBS
NB-ARC

EDEIVKILINNVSYSEEVPVLPILGMGGLGKTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKSLGDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTRLEKIGSIMGTLQLYQLSNLSQEDCWLLFKQRAFCHQTETSPKLMEIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDSEIWNLPQDENSVLPALRLSYHHLPLDLRQCFAYCAVFPKDTKIEKEYLIALWMAHSFL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

VLPILGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

LLNGKRYFLVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CGGVPLAAKTLGGLL

superfamily: SSF52058
471-830 SSF52058,LRR

KMHDLIHDLATSMFSASASSRSIRQINVKDDEDMMFIVTNYKDMMSIGFSEVVSSYSPSLFKRFVSLRVLNLSNSEFEQLPSSVGDLVHLRYLDLSGNKICSLPKRLCKLQNLQTLDLYNCQSLSCLPKQTSKLCSLRNLVLDHCPLTSMPPRIGLLTCLKTLGYFVVGERKGYQLGELRNLNLRGAISITHLERVKNDMEAKEANLSAKANLHSLSMSWDRPNRYESEEVKVLEALKPHPNLKYLEIIDFCGFCLPDWMNHSVLKNVVSILISGCENCSCLPPFGELPCLESLELQDGSVEVEYVEDSGFLTRRRFPSLRKLHIGGFCNLKGLQRMKGAEQFPVLEEMKISDCPMFVFP

Gene3D: G3DSA:3.80.10.10
513-633 G3DSA:3.80.10.10

DMMSIGFSEVVSSYSPSLFKRFVSLRVLNLSNSEFEQLPSSVGDLVHLRYLDLSGNKICSLPKRLCKLQNLQTLDLYNCQSLSCLPKQTSKLCSLRNLVLDHCPLTSMPPRIGLLTCLKTL

HMMPfam: PF12799
536-574 LRR_4,Leucine Rich repeats (2 copies)

SLRVLNLSNSEFEQLPSSVGDLVHLRYLDLSGNKICSLP

ProfileScan: PS51450
IPR001611
536-557 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLNLSNSEFEQLPSSVGDL

HMMSmart: SM00369
IPR003591
557-580 LRR_TYP
Leucine-rich repeat, typical subtype

LVHLRYLDLSGNKICSLPKRLCKL

ProfileScan: PS51450
IPR001611
559-581 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSGNKICSLPKRLCKLQ

FPrintScan: PR00364
IPR000767
578-594 DISEASERSIST
Disease resistance protein

CKLQNLQTLDLYNCQSL

ProfileScan: PS51450
IPR001611
582-604 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDLYNCQSLSCLPKQTSKL

HMMPfam: PF00560
IPR001611
582-599 LRR_1
Leucine-rich repeat

NLQTLDLYNCQSLSCLPK

HMMPfam: PF13504
606-621 LRR_7,Leucine rich repeat

SLRNLVLDHCPLTSMP

ProfileScan: PS51450
IPR001611
606-627 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRNLVLDHCPLTSMPPRIGLL

Gene3D: G3DSA:3.80.10.10
688-916 G3DSA:3.80.10.10

MSWDRPNRYESEEVKVLEALKPHPNLKYLEIIDFCGFCLPDWMNHSVLKNVVSILISGCENCSCLPPFGELPCLESLELQDGSVEVEYVEDSGFLTRRRFPSLRKLHIGGFCNLKGLQRMKGAEQFPVLEEMKISDCPMFVFPTLSSVKKLEIWGEADAGGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKNLENLIYLSVSFLENLKELPTSLASLNNLKCLDIRYCY

superfamily: SSF52058
832-988 SSF52058,LRR

LSSVKKLEIWGEADAGGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKNLENLIYLSVSFLENLKELPTSLASLNNLKCLDIRYCYALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHIPNV

HMMPfam: PF13855
893-941 LRR_8,Leucine rich repeat

NLKELPTSLASLNNLKCLDIRYCYALESLPEEGLEGLSSLTELFVEHCN

ProfileScan: PS51450
IPR001611
931-954 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTELFVEHCNMLKCLPEGLQHLT


List of References

Junqi Song, James M Bradeen, S Kristine Naess, John A Raasch, Susan M Wielgus, Geraldine T Haberlach, Jia Liu, Hanhui Kuang, Sandra Austin-Phillips, C Robin Buell, John P Helgeson, Jiming Jiang
Gene RB cloned from Solanum bulbocastanum confers broad spectrum resistance to potato late blight.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(16);9128-33
PubMed:12872003 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox