PRGDB00048587 (Disease resistance protein RGA1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32470628 (AY303170)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum chromosome 8 clone UW3A14, complete sequence.

DNA Sequence

GTTCTGTGTTAACTGAACCACAAGTTTATGGAAGGGACAAAGAAAAAGATGAGATAGTGAAAATCCTAATAAACACTGCTAGTGATGCCCAAAAACTCTCAGTCCTCCCAATACTTGGTATGGGGGGACTAGGAAAGACGACTCTTTCCCAAATGGTCTTCAATGATCAGAGAGTAACTGAGCGTTTCTATCCCAAAATATGGATTTGCATCTCGGATGATTTTAATGAGAAGAGGTTGATAAAGGCAATAGTAGAATCTATTGAAGGGAAGTCCCTCAGTGACATGGACTTGGCTCCACTTCAAAAGAAGCTTCAAGAGTTGCTGAATGGAAAAAGATACTTCCTTGTCTTAGATGATGTTTGGAATGAAGATCAACATAAGTGGGCTAATTTAAGAGCAGTCTTGAAGGTTGGAGCAAGTGGTGCATTTGTTCTAACTACTACTCGTCTTGAAAAGGTTGGATCAATTATGGGAACATTGCAACCATATGAATTGTCAAATCTGTCTCCAGAGGATTGTTGGTTTTTGTTCATGCAGCGTGCATTTGGACACCAAGAAGAAATAAATCCAAACCTTATGGCAATCGGAAAGGAGATTGTGAAAAAATGTGGTGGTGTGCCTCTAGCAGCCAAGACTCTTGGAGGTATTTTGCGCTTCAAGAGAGAAGAAAGAGAATGGGAACATGTGAGAGACAGTCCGATTTGGAATTTGCCTCAAGATGAAAGTTCTATTCTGCCTGCCCTGAGGCTTAGTTACCATCATCTTCCACTTGATTTGAGACAATGCTTTGTGTATTGTGCGGTATTCCCGAAGGACACCAAAATGGCAAAGGAAAATCTTATCGCTTTCTGGATGGCACACGGTTTTCTTTTATCGAAAGGAAATTTGGAGCTAGAGGATGTAGGTAATGAAGTATGGAATGAATTATACTTGAGGTCTTTCTTCCAAGAGATTGAAGTTGAATCTGGTAAAACTTATTTCAAGATGCATGACCTCATCCATGATTTGGCTACATCTCTGTTTTCAGCAAACACATCAAGCAGCAATATTCGTGAAATAAATGCTAATTATGATGGATATATGATGTCGATTGGTTTTGCTGAAGTGGTATCTTCTTACTCTCCGTCACTCTTGCAAAAGTTTGTCTCATTAAGGGTGCTTAATCTAAGAAACTCGAACCTAAATCAATTACCATCTTCCATTGGAGATCTAGTACATTTAAGATACCTGGACTTGTCTGGCAATTTTAGAATTCGTAATCTTCCAAAGAGATTATGCAAGCTTCAAAATCTGCAGACTCTTGATCTACATTATTGCGACTCTCTTTCTTGTTTGCCAAAACAAACAAGTAAACTTGGTAGTCTCCGAAATCTTTTACTTGATGGCTGTTCATTGACATCAACGCCACCAAGGATAGGATTGTTGACATGCCTTAAGTCTCTAAGTTGCTTTGTTATTGGCAAGAGAAAAGGTCATCAACTTGGTGAACTAAAAAACCTAAATCTCTATGGCTCAATTTCAATCACAAAACTTGACAGAGTGAAGAAAGATACGGATGCAAAAGAAGCTAATTTATCTGCTAAAGCAAATCTGCACTCTTTATGCCTGAGTTGGGATCTTGATGGAAAACATAGATATGATTCAGAAGTTCTTGAAGCCCTCAAACCACACTCCAATCTGAAATATTTAGAAATCAATGGCTTCGGAGGAATCCGTCTCCCAGATTGGATGAATCAATCAGTTTTGAAAAATGTTGTCTCTATTAGAATTAGAGGTTGTGAAAACTGCTCATGCTTACCACCCTTTGGTGAGCTGCCTTGTCTAGAAAGTCTAGAGTTACACACCGGGTCAGCGGATGTGGAGTATGTTGAAGATAATGTTCATCCTGGAAGGTTTCCATCCTTGAGGAAACTTGTTATATGGGACTTTAGTAATCTAAAAGGATTGCTGAAAATGGAAGGAGAAAAGCAATTCCCTGTGCTTGAAGAGATGACATTTTACTGGTGCCCTATGTTTGTTATTCCGACCCTTTCTTCTGTCAAGACATTGAAAGTTATTGTGACAGATGCAACAGTTTTGAGGTCCATATCTAATCTTAGGGCTCTTACTTCTCTCGACATTAGCGATAACGTAGAAGCTACTTCACTCCCAGAAGAGATGTTCAAAAGCCTTGCAAATCTCAAATACTTGAAAATCTCTTTCTTTAGGAATCTCAAAGAGTTGCCTACCAGCTTGGCTAGTCTCAATGCTTTGAAGAGCCTCAAATTTGAATTTTGTGACGCACTAGAGAGTCTCCCAGAGGAAGGGGTGAAAGGTTTAACTTCACTCACCGAGTTGTCTGTCAGTAACTGTATGATGCTAAAATGTTTACCGGAGGGATTGCAGCACCTAACAGCCCTCACAACTTTAACAATTACTCAATGTCCAATAGTATTCAAGCGGTGTGAGAGGGGAATAGGAGAAGACTGGCACAAAATTGCTCACATTCCATATTTGACTCTATATGAGTGAATGGCTGAAGCTTTCATTCAAGTTGTGCTAGACAATCTCACTTCTTTCCTCAAAGGGGAACTTGTATTGCTTTTCGGTTTTCAAGATGAGTTCCAAAGGCTTTCAAGCATGTTTTCTACAATCCAAGCCGTCCTTGAAGATGCTCAAGAGAAGCAACTCAACGACAAGCCTCTAGAAAATTGGTTGCAAAAACTCAATGCTGCTACATATGAAGTCGATGACATCTTGGATGAATATAAAACTAAGGCCACAAGATTCTTGCAGTCTGAATATGGCCGTTATCATCCAAAGGTTATCCCTTTCCGCCACAAGGTTGGGAAAAGGATGGATCAAGTGATGAAAAAACTGAATGCAATTGCTGAGGAACGAAAGAAGTTTCATTTGCAAGAAAAGATTATAGAGAGACAAGCTGCTACACGGGAAACAG


Protein sequences

Name Description Sequence
Disease resistance protein RGA1, putative Disease resistance protein RGA1, putative [Solanum bulbocastanum].

MAEAFIQVVLDNLTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNDKPLENWLQKLNAATYEVDDILDEYKTKATRFLQSEYGRYHPKVIPFRHKVGKRMDQVMKKLNAIAEERKKFHLQEKIIERQAATRETGSVLTEPQVYGRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIVFKRCERGIGEDWHKIAHIPYLTLYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-952 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNDKPLENWLQKLNAATYEVDDILDEYKTKATRFLQSEYGRYHPKVIPFRHKVGKRMDQVMKKLNAIAEERKKFHLQEKIIERQAATRETGSVLTEPQVYGRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCP

superfamily: SSF52540
134-383 SSF52540

ERQAATRETGSVLTEPQVYGRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQD

Gene3D: G3DSA:3.40.50.300
153-294 G3DSA:3.40.50.300

GRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLE

HMMPfam: PF00931
IPR002182
155-433 NB-ARC,NBS
NB-ARC

DKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

VLPILGMGGLGKTTLS

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

LLNGKRYFLVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CGGVPLAAKTLGGIL

superfamily: SSF52058
471-818 SSF52058,LRR

KMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIP

Gene3D: G3DSA:3.80.10.10
491-710 G3DSA:3.80.10.10

SNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEING

ProfileScan: PS51450
IPR001611
526-547 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLNLRNSNLNQLPSSIGDL

HMMPfam: PF00560
IPR001611
526-546 LRR_1
Leucine-rich repeat

SLRVLNLRNSNLNQLPSSIGD

HMMPfam: PF13855
549-608 LRR_8,Leucine rich repeat

HLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSL

ProfileScan: PS51450
IPR001611
549-572 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSGNFRIRNLPKRLCKLQ

FPrintScan: PR00364
IPR000767
569-585 DISEASERSIST
Disease resistance protein

CKLQNLQTLDLHYCDSL

ProfileScan: PS51450
IPR001611
573-595 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDLHYCDSLSCLPKQTSKL

ProfileScan: PS51450
IPR001611
597-618 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRNLLLDGCSLTSTPPRIGLL

Gene3D: G3DSA:3.80.10.10
724-954 G3DSA:3.80.10.10

VLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIV

superfamily: SSF52058
740-954 SSF52058,LRR

SCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIV

HMMPfam: PF13855
844-902 LRR_8,Leucine rich repeat

ALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFC

ProfileScan: PS51450
IPR001611
844-866 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALTSLDISDNVEATSLPEEMFKS

HMMPfam: PF00560
IPR001611
918-940 LRR_1
Leucine-rich repeat

SLTELSVSNCMMLKCLPEGLQHL


List of References

Junqi Song, James M Bradeen, S Kristine Naess, John A Raasch, Susan M Wielgus, Geraldine T Haberlach, Jia Liu, Hanhui Kuang, Sandra Austin-Phillips, C Robin Buell, John P Helgeson, Jiming Jiang
Gene RB cloned from Solanum bulbocastanum confers broad spectrum resistance to potato late blight.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(16);9128-33
PubMed:12872003 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox