PRGDB00048588 (Disease resistance protein, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 53749456 (AC151803)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Solanum demissum

Comment?

Solanum demissum chromosome 5 clone PGEC979H09, complete sequence.

DNA Sequence

GACATAAGATCAGTTGGACTCACAAAAAGGAAAAGTAACATCAACAGGATAAACATGGAAGGAAATTTATTTAGAGCAGAGGATCATGAAGACAGATTAGCAAGGAACAAATCAAGGCTAACAAATCTAAAAGATTTACTCATTCAAATGGAAGGAATCAGCATGGAGCAAATCAAGGCTAATGAATCATAAGGGACCATGACAGTGGAAGCAATCCAGTTTAGTTGCTTTGGAGAAGAACTATGCTTTAATAATGAGGCAATGAAAAAAATGAAAAGTCTTAGGATATTACACATAGTTGCTGCTCATACCAAATTCTTTGCTTCACGTCCCTCTTCGAATCACCATGATGACTCTATTGAGTACCTGTCCAATAACTTGCGTTGGTTAGTCTGGAATCGCTATTCTTGGAAGTCATTGCCAGAAAATTTTAAACCAGAAAAGCTTGTTTATCTTGAACTTCGTTGGAGTTCGCTGCATTATTTATGGAAGGAAACAAAGCTTCCGAAAAAACGTAGCAGAATATGGGACGTTGAAGATGTCAAAAAAGTGATGATAGACTATACAAAAAAAAGATGATTACGTCAATGATAAGTATGATGGGAAGTGCATGATTCCGAGCATACTTTGTTCTATGAAGGTGCTAATTGTGCTTGATGATATAGATCACAGTGAGCATTTGGAGTATTTAGCAGGTGATGTTGATTGGTTTGGTAATGGCAGTAGAGTCATTGTAACAACTAGAAACAAACATTTGATAGAGAAGGATGATGCGATATACGAAGTGTCTACACTACCTGATCATGAAGCTATGCTATTATTCAATAAGCATGCTTTTAAAAAAGAAGATCCAGATGAGAGTTTTAAGAAGTTCTCATTGGAGGTAGTAAATCACGCTAAAGGCCTTCCTTTAGCCCTCAAGGTGTGGGGTTGTTTATTGCATAAAAAATGTCTAACTTTGTGGAGAATAACTGTAGAGCAAATAAAGAAAAACTCTAATTCAGAAATTGTTAAAAAACTCAAAGATTGAATCAGAGAATATTCAACAGATCGTAGACTGCATCTCTTCCAAGTTTCGCACAAATGCTTATTCTTTATCTGTTTTGCAAGATGTTGTGGGAATAAACGATCACTTAAGAGAAACTAAAATCCAAACTTCAAATGGAAATCAACGATGTTCGGATTTTAGGGATCTGGGGAATAGGCGGAATCGTGAAAGCTTTGGAGCAGCATTTGCCAACCATGAATTAAAGTATAAGGATGATGTTGAGGGGATGCAGAAGGTGCAAAGATGGAGAAATGCCCTAACTGTTGCCGCAAATCTAAAAGGATATGATATCCGTGACGGATGGCATCTTCTTCTTCTTCTGCGAGTAATTCAAAGTATTGTCCTCAATGGAAGTACGTTGTGTTTTTAAGTTTTAGAGGTGAAGACACTCGAAAAATATTTACGGGTCACTTGTATGAAGGTTTGAAAAATAGGGGAATAAGCACCTTTCAAGATGATAAAAGGCTGGAGCATAGAGATTCAATTCCGAAAGAACTCTTGAGAGCTATCGAAGAGTCTCAAGTTGCACTTATTGTTTTCTCAAAGAATTATGCTACATCTAAGTG


Protein sequences

Name Description Sequence
Disease resistance protein, putative Disease resistance protein, putative [Solanum demissum].

MASSSSSASNSKYCPQWKYVVFLSFRGEDTRKIFTGHLYEGLKNRGISTFQDDKRLEHRDSIPKELLRAIEESQVALIVFSKNYATSKCESFGAAFANHELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRDGIESENIQQIVDCISSKFRTNAYSLSVLQDVVGINDHLRETKIQTSNGNQRCSDFRDLGNRRNRKKDDYVNDKYDGKCMIPSILCSMKVLIVLDDIDHSEHLEYLAGDVDWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMLLFNKHAFKKEDPDESFKKFSLEVVNHAKGLPLALKVWGCLLHKKCLTLWRITVEQIKKNSNSEIVKKLKLPKKRSRIWDVEDVKKVMIDYTGTMTVEAIQFSCFGEELCFNNEAMKKMKSLRILHIVAAHTKFFASRPSSNHHDDSIEYLSNNLRWLVWNRYSWKSLPENFKPEKLVYLELRWSSLHYLWKETKDIRSVGLTKRKSNINRINMEGNLFRAEDHEDRLARNKSRLTNLKDLLIQMEGISMEQIKANES

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
7-129 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SASNSKYCPQWKYVVFLSFRGEDTRKIFTGHLYEGLKNRGISTFQDDKRLEHRDSIPKELLRAIEESQVALIVFSKNYATSKCESFGAAFANHELKYKDDVEGMQKVQRWRNALTVAANLKGY

Gene3D: G3DSA:3.40.50.10140
16-99 G3DSA:3.40.50.10140

QWKYVVFLSFRGEDTRKIFTGHLYEGLKNRGISTFQDDKRLEHRDSIPKELLRAIEESQVALIVFSKNYATSKCESFGAAFANH

ProfileScan: PS50104
IPR000157
17-102 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKYVVFLSFRGEDTRKIFTGHLYEGLKNRGISTFQDDKRLEHRDSIPKELLRAIEESQVALIVFSKNYATSKCESFGAAFANHELK

HMMPfam: PF01582
IPR000157
21-96 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKIFTGHLYEGLKNRGISTFQDDKRLEHRDSIPKELLRAIEESQVALIVFSKNYATSKCESFGAAF

HMMPfam: PF00931
IPR002182
188-341 NB-ARC,NBS
NB-ARC

FRDLGNRRNRKKDDYVNDKYDGKCMIPSILCSMKVLIVLDDIDHSEHLEYLAGDVDWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMLLFNKHAFKKEDPDESFKKFSLEVVNHAKGLPLALKVWGCLLHKKCLTLWRITVEQIKKNSN

HMMPanther: PTHR11017:SF20
212-478 PTHR11017:SF20,SUBFAMILY NOT NAMED

MIPSILCSMKVLIVLDDIDHSEHLEYLAGDVDWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMLLFNKHAFKKEDPDESFKKFSLEVVNHAKGLPLALKVWGCLLHKKCLTLWRITVEQIKKNSNSEIVKKLKLPKKRSRIWDVEDVKKVMIDYTGTMTVEAIQFSCFGEELCFNNEAMKKMKSLRILHIVAAHTKFFASRPSSNHHDDSIEYLSNNLRWLVWNRYSWKSLPENFKPEKLVYLELRWSSLHYLWKETKDIRS

HMMPanther: PTHR11017
212-478 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MIPSILCSMKVLIVLDDIDHSEHLEYLAGDVDWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMLLFNKHAFKKEDPDESFKKFSLEVVNHAKGLPLALKVWGCLLHKKCLTLWRITVEQIKKNSNSEIVKKLKLPKKRSRIWDVEDVKKVMIDYTGTMTVEAIQFSCFGEELCFNNEAMKKMKSLRILHIVAAHTKFFASRPSSNHHDDSIEYLSNNLRWLVWNRYSWKSLPENFKPEKLVYLELRWSSLHYLWKETKDIRS

FPrintScan: PR00364
IPR000767
216-230 DISEASERSIST
Disease resistance protein

ILCSMKVLIVLDDID

superfamily: SSF52540
221-344 SSF52540

KVLIVLDDIDHSEHLEYLAGDVDWFGNGSRVIVTTRNKHLIEKDDAIYEVSTLPDHEAMLLFNKHAFKKEDPDESFKKFSLEVVNHAKGLPLALKVWGCLLHKKCLTLWRITVEQIKKNSNSEI

FPrintScan: PR00364
IPR000767
307-321 DISEASERSIST
Disease resistance protein

AKGLPLALKVWGCLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox