PRGDB00048589 (Disease resistance protein I2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein I2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 53749428 (AC151801)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Solanum demissum

Comment?

Solanum demissum chromosome 11 clone PGEC591C22, complete sequence.

DNA Sequence

ATTTCAGAAATGGAGATTGGCTTAGCAATTGGTGGTGCATTTCTCTCTTCAGCTTTGAATGTTCTGTTTGATAGGCTTGCTCCTCAGGGTGATCTTCCCAACATGTTTCAGAAGCATAAACATCATGTTCGGCTCTTAAAGAAGCTGAAAATGACTTTGCGTGGTCTTCAGATTGTGCTAAGTGATGCAGAGAATAAGCAAGCATCAAATCCATCTGTGCGTGACTGGCTTAATGAGCTTCGAGATGCTGTCGACTCTGCTGAAAACTTAATAGAACAAGTCAATTATGAAGCTTTGAGACTTAAGGTGGAAGGTCAGCATCAGAATTTTGCAGAAACAAGCTACCAGCAAGTAAGTGACCTCAACCTTTGCTTGAGTGATGAATTTTTACTTAACATAAAGGACAAGTTGGAAGACACTATTGAAACATTAAAGGATTTGCAAGAGCAAATTGGTCTCCTTGGCTTAAAGGAGTATTTTGGTTCCCCGAAACTAGAAACTAGAAGACCTTCAACTTCTGTGGATGATGAATCTGATATCTTTGGTAGGCAGAGCGAAATAGAGGATTTGATTGACCGTTTATTGTCTGAAGATGCAAGTGGGAAAAAGCTGACAGTAGTTCCTATTGTTGGAATGGGCGGCCTGGGTAAGACAACACTTGCTAAAGCCGTTTACAATGATGAGAGGGTGAAGAACCATTTTGGTTTGAAAGCTTGGTATTGTGTTTCTGAGGGATATGATGCTTTGAGAATAACAAAAGGGTTACTTCAAGAAATTGGCAAATTTGACTCAAAGGATGTCCACAACAATCTTAATCAGCTTCAAGTCAAATTGAAGGAAAGCTTGAAGGAAAAGAAGTTCCTTATTGTTTTGGATGATGTGTGGAATGACAACTACAACGAGTGGGATGACTTGAGAAATACTTTTGTACAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGCAAAGAGAGTGTTGCCTTGATGATGGGAAATGAGCAAATTAGCATGGACAATTTGTCTACTGAAGCCTCTTGGTCTTTATTTAAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGAAACCAAATTGCAGCTAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATAGTACCAGCATTGATGTTGAGCTACAATGACCTTCCTGCACATTTAAAGCGATGTTTTTCCTATTGTGCAATATTTCCTAAAGATTATTCATTTAGGAAAGAGCAAGTTATTCATCTGTGGATTGCCAATGGTCTCGTACAAAAGGAAGATGAAATAATTGAAGATTCAGGCAACCAATACTTTCTCGAATTGAGATCAAGATCATTATTCGAAAAGGTACCAAATCCTTCTGTAGGGAACATTGAGGAATTATTCTTAATGCATGACCTTATCAATGATTTAGCCCAAATTGCATCTTCAAAACTTTGTATCAGGTTGGAAGAGAGCCAAGGATCTCATATGTTGGAAAAAAGTCGGCACTTATCTTATTCAATGGGAGAAGGTGGTGAGTTTGAGAAATTGACAACCCTCTACAAATTGGAGCAGCTGAGGACATTGCTTCCGATATATATTGATGTCAATTATTACTCTCTGAGCAAGAGGGTGCTGTATAACATACTGCCAAGACTAAGATCCTTAAGGGTACTATCATTGTCTTATTACAATATTAAGGAGTTGCCAAATGACTTATTTATCGAATTAAAGCTCCTGAGATTTTTGGATATTTCTCGGACAAAGATTAAAAGGTTGCCAGATTCCATTTGTGTGTTGTATAACTTAGAGACACTTCTCCTTTCATCTTGTGCTGATCTTGAGGAGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCGTCATCTTGACATAAGCAACACTTCTCTCTTGAAGATGCCACTACATCTGAGCAAGTTGAAAAGCCTCCAAGTGTTAGTGGGAGCCAAGTTTCTTCTAAGTGGTTGGAGAATGGAAGATTTGGGTGAAGCACAGAACTTGTATGGATCTGTATCAGTTGTAGAGTTGGAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGTTGACAAGTTATCTTTGGAGTGGAGTGAAAGTAGTAGTGCCGACAATTCACAAACTGAAAGAGACATACTTGATGAGCTACGCCCACATAAAAACATAAAAGAAGTTGAGATTACGGGATATAGAGGGACAAAATTTCCTAATTGGCTAGCTGATCCTTTGTTTCTTAAGCTAGTACAGTTGTCTATTGATAACTGCAAGGACTGTTATACCTTGCCAGCACTAGGACAACTCCCTTGTTTGAAATTCCTTTCGATTAGTGGGATGCATGGAATAACAGAGGTGACGGAAGAATTCTATGGTAGTTTTTCCTCCAAAAAGCCTTTTAACTGTCTTGAGAAGCTTGCATTTGAAGATATGCCGGAGTGGAAGCAATGGCACGTACTAGGTAGTGGAGAGTTCCCTATACTTGAGAAGCTTTTCATTAAAAATTGCCCTGAACTCAGTTTGGAGACACCCATCCAACTTTCAAGTTTAAAAAGTTTTGAAGTTAGTGGTTGTCCAAAGGTTGGAGTTGTTTTTGATGATGCTCAATTGTTTAGATCCCAACTTGAGGGAATGAAGCAGATTGTTGAATTATATATTAGTTATTGTAACTCTGTTACCTTCTTACCTTTTAGCATACTGCCCACTACCTTGAAGAGAATAGAGATATCTCGTTGCCGGAAATTGAAATTGGAAGCGCCAGTTGGTGAGATGAGTATGTTTCTCGAGGAATTGAGAGTGGAAGGAAGTGATTGTATAGATGTTATATCACCTGAGTTACTCCCAAGAGCACGCAATTTGAGGGTAGTCAGTTGCCATAACCTTACAAGGGTTTTGATTCCTACTGCCACTGCATTTCTCTGTATTTGGGATTGTGAGAATGTTGAAAAACTATCGGTGGCATGTGGGGGGACCCTGATGACGTCACTGACTATTGGGTGCTGTTCAAAGCTGAAGTGTCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAAGGAACTGGATCTGCGTAAATGTCCAGAAATAGAGTCTTTTCCTCAAGGAGGATTGCCCTTCAATTTACAAATCCTTGAGATCAGCGAGTGCAAGAAACTGGTGAACGGCCGAAAGGAGTGGCGTTTACAGAGACTCTCTCAGCTGGCCATCTATGGTTGCCCTAATCTCCAATCACTTTCTGAATCAGCACTGCCCTCCTCCCTCTCTAAGCTGACCATCATTGGGTGCCCTAATCTCCAATCTCTTCCAGTAAAAGGGATGCCCTCTTCCCTCTCTGAACTACATATTTCAGAATGTCCATTGCTCACAGCACTACTAGAATTTGACAAGGGGGAATACTGGCCAAATATTGCTCAATTTCCCACCATAGACATCGAAGAGGAATGCATGTGAATGAAGACAAAGTGTTGTTGTTGGGTGAAAAGTGATACTCATGAAAAGGACAAAAAG


Protein sequences

Name Description Sequence
Disease resistance protein I2, putative Disease resistance protein I2, putative [Solanum demissum].

MKTKCCCWVKSDTHEKDKKISEMEIGLAIGGAFLSSALNVLFDRLAPQGDLPNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEQVNYEALRLKVEGQHQNFAETSYQQVSDLNLCLSDEFLLNIKDKLEDTIETLKDLQEQIGLLGLKEYFGSPKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEGYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNTFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGNQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDIVPALMLSYNDLPAHLKRCFSYCAIFPKDYSFRKEQVIHLWIANGLVQKEDEIIEDSGNQYFLELRSRSLFEKVPNPSVGNIEELFLMHDLINDLAQIASSKLCIRLEESQGSHMLEKSRHLSYSMGEGGEFEKLTTLYKLEQLRTLLPIYIDVNYYSLSKRVLYNILPRLRSLRVLSLSYYNIKELPNDLFIELKLLRFLDISRTKIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTSLLKMPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSVSVVELENVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTKFPNWLADPLFLKLVQLSIDNCKDCYTLPALGQLPCLKFLSISGMHGITEVTEEFYGSFSSKKPFNCLEKLAFEDMPEWKQWHVLGSGEFPILEKLFIKNCPELSLETPIQLSSLKSFEVSGCPKVGVVFDDAQLFRSQLEGMKQIVELYISYCNSVTFLPFSILPTTLKRIEISRCRKLKLEAPVGEMSMFLEELRVEGSDCIDVISPELLPRARNLRVVSCHNLTRVLIPTATAFLCIWDCENVEKLSVACGGTLMTSLTIGCCSKLKCLPERMQELLPSLKELDLRKCPEIESFPQGGLPFNLQILEISECKKLVNGRKEWRLQRLSQLAIYGCPNLQSLSESALPSSLSKLTIIGCPNLQSLPVKGMPSSLSELHISECPLLTALLEFDKGEYWPNIAQFPTIDIEEECM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
36-902 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SALNVLFDRLAPQGDLPNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEQVNYEALRLKVEGQHQNFAETSYQQVSDLNLCLSDEFLLNIKDKLEDTIETLKDLQEQIGLLGLKEYFGSPKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEGYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNTFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGNQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDIVPALMLSYNDLPAHLKRCFSYCAIFPKDYSFRKEQVIHLWIANGLVQKEDEIIEDSGNQYFLELRSRSLFEKVPNPSVGNIEELFLMHDLINDLAQIASSKLCIRLEESQGSHMLEKSRHLSYSMGEGGEFEKLTTLYKLEQLRTLLPIYIDVNYYSLSKRVLYNILPRLRSLRVLSLSYYNIKELPNDLFIELKLLRFLDISRTKIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTSLLKMPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSVSVVELENVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTKFPNWLADPLFLKLVQLSIDNCKDCYTLPALGQLPCLKFLSISGMHGITEVTEEFYGSFSSKKPFNCLEKLAFEDMPEWKQWHVLGSGEFPILEKLFIKNCPEL

HMMPanther: PTHR23155:SF236
36-902 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

SALNVLFDRLAPQGDLPNMFQKHKHHVRLLKKLKMTLRGLQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEQVNYEALRLKVEGQHQNFAETSYQQVSDLNLCLSDEFLLNIKDKLEDTIETLKDLQEQIGLLGLKEYFGSPKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEGYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNTFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGNQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDIVPALMLSYNDLPAHLKRCFSYCAIFPKDYSFRKEQVIHLWIANGLVQKEDEIIEDSGNQYFLELRSRSLFEKVPNPSVGNIEELFLMHDLINDLAQIASSKLCIRLEESQGSHMLEKSRHLSYSMGEGGEFEKLTTLYKLEQLRTLLPIYIDVNYYSLSKRVLYNILPRLRSLRVLSLSYYNIKELPNDLFIELKLLRFLDISRTKIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTSLLKMPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSVSVVELENVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTKFPNWLADPLFLKLVQLSIDNCKDCYTLPALGQLPCLKFLSISGMHGITEVTEEFYGSFSSKKPFNCLEKLAFEDMPEWKQWHVLGSGEFPILEKLFIKNCPEL

superfamily: SSF52540
182-433 SSF52540

PKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEGYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNTFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGNQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

Gene3D: G3DSA:3.40.50.300
196-318 G3DSA:3.40.50.300

ESDIFGRQSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEGYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNY

HMMPfam: PF00931
IPR002182
202-485 NB-ARC,NBS
NB-ARC

RQSEIEDLIDRLLSEDASGKKLTVVPIVGMGGLGKTTLAKAVYNDERVKNHFGLKAWYCVSEGYDALRITKGLLQEIGKFDSKDVHNNLNQLQVKLKESLKEKKFLIVLDDVWNDNYNEWDDLRNTFVQGDIGSKIIVTTRKESVALMMGNEQISMDNLSTEASWSLFKRHAFENMDPMGHPELEEVGNQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDIVPALMLSYNDLPAHLKRCFSYCAIFPKDYSFRKEQVIHLWIANGLVQKED

FPrintScan: PR00364
IPR000767
225-240 DISEASERSIST
Disease resistance protein

VVPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
300-314 DISEASERSIST
Disease resistance protein

SLKEKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
396-410 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

superfamily: SSF52058
521-976 SSF52058,LRR

LMHDLINDLAQIASSKLCIRLEESQGSHMLEKSRHLSYSMGEGGEFEKLTTLYKLEQLRTLLPIYIDVNYYSLSKRVLYNILPRLRSLRVLSLSYYNIKELPNDLFIELKLLRFLDISRTKIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTSLLKMPLHLSKLKSLQVLVGAKFLLSGWRMEDLGEAQNLYGSVSVVELENVVDRREAVKAKMREKNHVDKLSLEWSESSSADNSQTERDILDELRPHKNIKEVEITGYRGTKFPNWLADPLFLKLVQLSIDNCKDCYTLPALGQLPCLKFLSISGMHGITEVTEEFYGSFSSKKPFNCLEKLAFEDMPEWKQWHVLGSGEFPILEKLFIKNCPELSLETPIQLSSLKSFEVSGCPKVGVVFDDAQLFRSQLEGMKQIVELYISYCNSVTFLPFSILPTTLKRIEISRCR

Gene3D: G3DSA:3.80.10.10
595-713 G3DSA:3.80.10.10

KRVLYNILPRLRSLRVLSLSYYNIKELPNDLFIELKLLRFLDISRTKIKRLPDSICVLYNLETLLLSSCADLEELPLQMEKLINLRHLDISNTSLLKMPLHLSKLKSLQVLVGAKFLLS

FPrintScan: PR00364
IPR000767
674-690 DISEASERSIST
Disease resistance protein

EKLINLRHLDISNTSLL

Gene3D: G3DSA:3.80.10.10
775-859 G3DSA:3.80.10.10

RDILDELRPHKNIKEVEITGYRGTKFPNWLADPLFLKLVQLSIDNCKDCYTLPALGQLPCLKFLSISGMHGITEVTEEFYGSFSS

Gene3D: G3DSA:3.80.10.10
891-915 G3DSA:3.80.10.10

LEKLFIKNCPELSLETPIQLSSLKS

Gene3D: G3DSA:3.80.10.10
916-1032 G3DSA:3.80.10.10

FEVSGCPKVGVVFDDAQLFRSQLEGMKQIVELYISYCNSVTFLPFSILPTTLKRIEISRCRKLKLEAPVGEMSMFLEELRVEGSDCIDVISPELLPRARNLRVVSCHNLTRVLIPTA

superfamily: SSF52058
938-1201 SSF52058,LRR

LEGMKQIVELYISYCNSVTFLPFSILPTTLKRIEISRCRKLKLEAPVGEMSMFLEELRVEGSDCIDVISPELLPRARNLRVVSCHNLTRVLIPTATAFLCIWDCENVEKLSVACGGTLMTSLTIGCCSKLKCLPERMQELLPSLKELDLRKCPEIESFPQGGLPFNLQILEISECKKLVNGRKEWRLQRLSQLAIYGCPNLQSLSESALPSSLSKLTIIGCPNLQSLPVKGMPSSLSELHISECPLLTALLEFDKGEYWPNIAQ

Gene3D: G3DSA:3.80.10.10
1070-1183 G3DSA:3.80.10.10

LPERMQELLPSLKELDLRKCPEIESFPQGGLPFNLQILEISECKKLVNGRKEWRLQRLSQLAIYGCPNLQSLSESALPSSLSKLTIIGCPNLQSLPVKGMPSSLSELHISECPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox