PRGDB00048590 (Disease resistance protein I2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein I2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 53749428 (AC151801)
Gene Class RLP
Domain Type LRR, Receptor-Like Kinase, Ser-Thr Kinase
Gene Species Solanum demissum

Comment?

Solanum demissum chromosome 11 clone PGEC591C22, complete sequence.

DNA Sequence

GTGGAGATATACAGCCGTTGTTATGAGAAACAACCTTTGGTTATCCAAGGTGCTGGAGCAGGAAATGATACCACAGCAGCTGGTGTCCTAGCTGATATCCCTGACATTCAAGATTTATTCCCGTGAATATGAAGTTGGCATCCAAGAAGTTCCAAAAGATTCTGCATTGGGAAGATTAAGAGGAAGTGATGATGTGAAGTAGAATGTATATACAGAAGGTATCACACTATCACTGTCCATTCTGCATCGAAATTGTCTTTGATTTTCGTTGATAATCCTTTCCAAGAGAAAGCTCCTTCCCCAAAAGATGCAAATCATTGCATCCTAGTGAATATGACATGGCGAATACTGAAATTGATTCACAATTTCAGTTGGAAAGGCAACATCAGGTACCCTGGGGTATGTAATGAGTGAGGTTGAGGATGGAAAGCCATTCAGCCAAGTCATTAATGCTGCTAAAAGCCTTGTCTACACTGAACCAGCCAAATAGATTTCCTTCATTGGCACCCTCATCAGTCATCAATCAGCGAAACAGGGAAATCAACAGTTTCAAAATGATTATCCTTAGTGAGATGAAGTCTCTATGAGAGTGGTTGGAGTTGTTTTTGATGATGCTCAACTATTTACCTCCCAACTTGAGGGAATGAAGCAGATTGAGGAATTAACTATTATTGATTGTAACTCTCTTACTTCCTTACCTTTTAGCATACTGCCCACTACCTTGAAGATAATAGAGATATCTCGTTGCCGGAAATTGAAATTGGAGCAGCCAGTTGGTGAGATGAGTATGTTTCTCGAGGAATTGAAACTGGAGGGATGTGATTGTATAGATGATATATCACCTGAGTTGTTCCCAAGAGCAGGCGATTTGTGTGTAGTCAGTTGCCACAACCTTACTAGGTTTTTGATTCCTACTTCCACTGAAACTCTCTCTATTCAGAATTGTGAGAATGTTGAAAAACTTTCGGTGGCATGTGGGGGGACCCAGATGACGTCACTGCGTATTAAGGGCTGTAAGAAGCTGAAGTGGCTGCCAGAACGTATGCAGGAACTCCTTCCATCTCTTAAGGTACTGGATCTGCGTAATTGTCCAGAAATAGAGTTCTTTCCTGAAGGAGGATTGCCCTTCAATTTACAAGCCCTTGGCATCAGAAATTGCAATAAACTGGTGAATGGCAGAAAGGAGTGGCGTTTACAGAGACTCCCCTGTCTCAACCTTTTAGGGATCAAACATGATGGCAGTGACGAAGAGATTGTTGGTGGTGAGAATTGGGAGTTGTCTTCCTCTATTCAAAGACTTTTCATAAGCAATCTGAAAACATTAAGCAGCCAAGTTCTCAAAAGCCTCACCTCTCTTCAATATCTAGAAATTCATGGTAATTTACCTCAAATTCAGTCAATGCTGGAACAAGGCCAGTTTTCGCACCTCACTTCGCTTCAACGTCTACAAATCATTGATTTCCCTAATCTCCAATCACTTCCTGAATCAGCACTGCCCTCCTCCCTCTCTCAGCTGACCATCTCCAATTGCCCTAAGCTCCAATCCCTTCCATTAAAAGAGATGCCCTCTTCCCTCTCTAACCTAGAAATTTATGACTGCCCATTGCTCAAACCACTACTAGAATTTAACAAGGGGAAATACTGGCCAAATATTGCTCAAATTCCCGTCATATTTATCAATGGGAAATGCATTATGTTGGCAAACCCTGTTCATATCTGGTTTTGGGAGGAAATTGTCTCATACATGTCCCGTTGGGTCTAATGATTTGCTTCTCTGGCTCATTCATATACATTGGTGAAGTCTCGCTATCTTCTGCTCGTCGTCCCGTTCGCTGCTCGCAACAAGATGAGTAGCAGCAGCTCACGATCCCAACCAACAACGTCAAAATACACGGAGCAGTACACAGAAGAACAGAACGAGGAACAGTACTCTGCCTCTCATTGGCGTCTTCCTCACGTCCTTCTCACTTGCAGCAACAAAAGCACCTGCCAGCCTGCATTTTCGTCCTTGCCAGCGCGAGATGAAAACACGTCGAGCGGCAG


Protein sequences

Name Description Sequence
Disease resistance protein I2, putative Disease resistance protein I2, putative [Solanum demissum].

MSSSSSRSQPTTSKYTEQYTEEQNEEQYSASHWRLPHVLLTCSNKSTCQPAFSSLPARDENTSSGRYIGEVSLSSARRPVRCSQQVCWQTLFISGFGRKLSHTCPVGSNDLLLWLIHVGVVFDDAQLFTSQLEGMKQIEELTIIDCNSLTSLPFSILPTTLKIIEISRCRKLKLEQPVGEMSMFLEELKLEGCDCIDDISPELFPRAGDLCVVSCHNLTRFLIPTSTETLSIQNCENVEKLSVACGGTQMTSLRIKGCKKLKWLPERMQELLPSLKVLDLRNCPEIEFFPEGGLPFNLQALGIRNCNKLVNGRKEWRLQRLPCLNLLGIKHDGSDEEIVGGENWELSSSIQRLFISNLKTLSSQVLKSLTSLQYLEIHGNLPQIQSMLEQGQFSHLTSLQRLQIIDFPNLQSLPESALPSSLSQLTISNCPKLQSLPLKEMPSSLSNLEIYDCPLLKPLLEFNKGKYWPNIAQIPVIFINGKCIDEVSMRVPNRFPSLAPSSVINQRNREINSFKMIILSGTLGYVMSEVEDGKPFSQVINAAKSLVYTEPEVECIYRRYHTITVHSASKLSLIFVDNPFQEKAPSPKDANHCILVNMTWRILKLIHNFSWKGNIRYEVGIQEVPKDSALGRLRGSDDVVEIYSRCYEKQPLVIQGAGAGNDTTAAGVLADIPDIQDLFP

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
99-473 SSF52058,LRR

KLSHTCPVGSNDLLLWLIHVGVVFDDAQLFTSQLEGMKQIEELTIIDCNSLTSLPFSILPTTLKIIEISRCRKLKLEQPVGEMSMFLEELKLEGCDCIDDISPELFPRAGDLCVVSCHNLTRFLIPTSTETLSIQNCENVEKLSVACGGTQMTSLRIKGCKKLKWLPERMQELLPSLKVLDLRNCPEIEFFPEGGLPFNLQALGIRNCNKLVNGRKEWRLQRLPCLNLLGIKHDGSDEEIVGGENWELSSSIQRLFISNLKTLSSQVLKSLTSLQYLEIHGNLPQIQSMLEQGQFSHLTSLQRLQIIDFPNLQSLPESALPSSLSQLTISNCPKLQSLPLKEMPSSLSNLEIYDCPLLKPLLEFNKGKYWPNIAQ

Gene3D: G3DSA:3.80.10.10
135-308 G3DSA:3.80.10.10

MKQIEELTIIDCNSLTSLPFSILPTTLKIIEISRCRKLKLEQPVGEMSMFLEELKLEGCDCIDDISPELFPRAGDLCVVSCHNLTRFLIPTSTETLSIQNCENVEKLSVACGGTQMTSLRIKGCKKLKWLPERMQELLPSLKVLDLRNCPEIEFFPEGGLPFNLQALGIRNCNK

HMMPfam: PF00560
IPR001611
274-294 LRR_1
Leucine-rich repeat

SLKVLDLRNCPEIEFFPEGGL

Gene3D: G3DSA:3.80.10.10
347-455 G3DSA:3.80.10.10

SSSIQRLFISNLKTLSSQVLKSLTSLQYLEIHGNLPQIQSMLEQGQFSHLTSLQRLQIIDFPNLQSLPESALPSSLSQLTISNCPKLQSLPLKEMPSSLSNLEIYDCPL

superfamily: SSF55347
502-660 SSF55347

SVINQRNREINSFKMIILSGTLGYVMSEVEDGKPFSQVINAAKSLVYTEPEVECIYRRYHTITVHSASKLSLIFVDNPFQEKAPSPKDANHCILVNMTWRILKLIHNFSWKGNIRYEVGIQEVPKDSALGRLRGSDDVVEIYSRCYEKQPLVIQGAGAG

HMMPfam: PF00742
IPR001342
510-552 Homoserine_dh
Homoserine dehydrogenase, catalytic

EINSFKMIILSGTLGYVMSEVEDGKPFSQVINAAKSLVYTEPE

Gene3D: G3DSA:3.30.360.10
518-655 G3DSA:3.30.360.10

ILSGTLGYVMSEVEDGKPFSQVINAAKSLVYTEPEVECIYRRYHTITVHSASKLSLIFVDNPFQEKAPSPKDANHCILVNMTWRILKLIHNFSWKGNIRYEVGIQEVPKDSALGRLRGSDDVVEIYSRCYEKQPLVIQ

HMMPanther: PTHR21499
519-679 PTHR21499,ASPARTATE KINASE

LSGTLGYVMSEVEDGKPFSQVINAAKSLVYTEPEVECIYRRYHTITVHSASKLSLIFVDNPFQEKAPSPKDANHCILVNMTWRILKLIHNFSWKGNIRYEVGIQEVPKDSALGRLRGSDDVVEIYSRCYEKQPLVIQGAGAGNDTTAAGVLADIPDIQDLF

HMMPanther: PTHR21499:SF8
519-679 PTHR21499:SF8,HOMOSERINE DEHYDROGENASE FAMILY PROTEIN

LSGTLGYVMSEVEDGKPFSQVINAAKSLVYTEPEVECIYRRYHTITVHSASKLSLIFVDNPFQEKAPSPKDANHCILVNMTWRILKLIHNFSWKGNIRYEVGIQEVPKDSALGRLRGSDDVVEIYSRCYEKQPLVIQGAGAGNDTTAAGVLADIPDIQDLF

HMMPfam: PF00742
IPR001342
604-672 Homoserine_dh
Homoserine dehydrogenase, catalytic

KLIHNFSWKGNIRYEVGIQEVPKDSALGRLRGSDDVVEIYSRCYEKQPLVIQGAGAGNDTTAAGVLADI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox