PRGDB00048595 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32470640 (AY303171)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum chromosome 8 clone UW177O13, complete sequence.

DNA Sequence

ATGGCTGAAGCTTTCATTCAAGTTGTGCTAGACAATCTCACTTCTTTCCTCAAAGGGGAACTTGTATTGCTTTTCGGTTTTCAAGATGAGTTCCAAAGGCTTTCAAGCATGTTTTCTACAATCCAAGCCGTCCTTGAAGATGCTCAAGAGAAGCAACTCAACGACAAGCCTCTAGAAAATTGGTTGCAAAAACTCAATGCTGCTACATATGAAGTCGATGACATCTTGGATGAATATAAAACTAAGGCCACAAGATTCTTGCTGTCTGAATATGGCCGTTATCATCCAAAGGTTATCCCTTTCCGTCACAAGGTTGGGAAAAGGATGGACCAAGTGATGAAAAAACTGAATGCAATTGCTGAGGAACGAAAGAATTTTCATTTGCAAGAAAAGATTATAGAGAGACAAGCTGCTACACGGGAAACAGGTTCTGTGTTAACTGAATCACAAGTTTATGGAAGGGACAAAGAAAAAGATGAGATAGTGAAAATCCTAACAAACACTGCTAGTGATGCCCAAAAACTCTCAGTCCTCCCAATACTTGGTATGGGGGGACTAGGAAAGACGACTCTTTCCCAAATGGTCTTCAATGATCAGAGAGTAACTGAGCGTTTCTATCCCAAAATATGGATTTGCGTCTCGGATGATTTTAATGAGAAGAGGTTGATAAAGGCAATAGTAGAATCTATTGAAGGGAAGTCCCTCAGTGACATGGACTTGGCTCCACTTCAAAAGAAGCTTCAAGAGTTGCTGAATGGAAAAAGATACTTCCTTGTCTTAGATGATGTTTGGAATGAAGATCAACATAAGTGGGCTAATTTAAGAGCAGTCTTGAAGGTTGGAGCAAGTGGTGCATTTGTTCTAACAACTACTCGTCTTGAAAAGGTTGGATCAATTATGGGAACATTGCAACCATATGAATTGTCAAATCTGTCTCCAGAGGATTGTTGGTTTTTGTTCATGCAGCGTGCATTTGGACACCAAGAAGAAATAAATCCAAACCTTGTGGCAATCGGAAAGGAGATTGTGAAAAAATGTGGTGGTGTGCCTCTAGCAGCCAAGACTCTTGGAGGTATTTTGCGCTTCAAGAGAGAAGAAAGAGAATGGGAACATGTGAGAGACAGTCCGATTTGGAATTTGCCTCAAGATGAAAGTTCTATTCTGCCTGCCCTGAGGCTTAGTTACCATCATCTTCCACTTGATTTGAGACAATGCTTTGTGTATTGTGCGGTATTCCCAAAGGACACCAAAATGGCAAAGGAAAATCTTATCGCTTTTTGGATGGCACATGGTTTTCTTTTATCGAAAGGAAATTTGGAGCTAGAGGATGTAGGTAATGAAGTATGGAATGAATTATACTTGAGGTCTTTCTTCCAAGAGATTGAAGTTGAATCTGGTAAAACTTATTTCAAGATGCATGACCTCATCCATGATTTGGCTACGTCTCTGTTTTCAGCAAACACATCAAGCAGCAATATTCGTGAAATAAATGCTAATTATGATGGATATATGATGTCGATTGGTTTCGCTGAAGTGGTGTCTTCTTACTCTCCTTCACTCTTGCAAAAGTTTGTCTCATTAAGGGTGCTTAATCTAAGAAACTCGAACCTAAATCAATTACCATCTTCCATTGGAGATCTAGTACATTTAAGATACCTGGACTTGTCTGGCAATGTTAGAATTCGTAGTCTTCCAAGGAGATTATGCAAGCTTCAAAATCTGCAGACTCTTGATCTACATTATTGCGACTCTCTTTCTTGTTTGCCAAAACAAACAAAGAAAGGTTATCAACTTGGTGAACTAAAAAACCTAAATCTCTATGGCTCAATTTCAATCACAAAACTTGACAGAGTGAAGAAAGATACGGATGCAAAAGAAGCTAATTTATCTGCTAAAGCAAACCTGCACTCTTTATGCCTGAGTTGGGATCTTGATGGAAAACATAGATATGATTCAGAAGTTCTTGAAGCCCTCAAACCACACTCCAATCTGAAATATTTAGAAATCAATGGCTTCGGAGGAATCCTTCTCCCAGACTGGATGAATCAATCAGTTTTGAAAAATGTTGTCTCTATTAGAATTAGAGGTTGTGAAAACTGCTCGTGCTTACCACCCTTTGGTGAGCTGCCTTGTCTAGAAAGTCTAGAGTTACACACAGGGTCAGCGGAGGTGGAGTATGTTGAAGATAATGTTCATCCTGGAAGGTTTCCATCCTTGAGGGAACTTCTGAAAAAGGAAGGAGAAAAGCAATTCCCTGTGCTTGAAGAGATGACATTTTACTGGTGCCCTATGTTTGTTATTCCGACCCTTTCTTCTGTCAAGACATTGAAAGTTATTGCGACAGATGCAACAGTTTTGAGGTCCATATCTAATCTTAGGGCTCTTACTTCCCTCGACATTAGCAATAACGTAGAAGCTACTTCACTCCCAGAAGAGATGTTCAAAAGCCTTGCAAATCTCAAATACTTGAATATCTCTTTCTTTAGGAATCTCAAAGAGTTGCCTACCAGCCTGGCTAGTCTCAATGCTTTGAAGAGTCTCAAATTTGAATTTTGTGACGCACTAGAGAGTCTCCCAGAGGAAGGGGTGAAAGGTTTAACTTCACTCACCGAGTTGTCTGTCAGTAACTGTATGATGCTAAAATGTTTACCGGAGGGATTGCAGCACCTAACAGCCCTCACAACTTTAACAATTACTCAATGTCCAATAGTATTCAAGCGGTGTGAGAGGGGAATAGGAGAAGACTGGCACAAAATTTCTCACATTCCATATTTGACTCTATATGAATGA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Solanum bulbocastanum].

MAEAFIQVVLDNLTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNDKPLENWLQKLNAATYEVDDILDEYKTKATRFLLSEYGRYHPKVIPFRHKVGKRMDQVMKKLNAIAEERKNFHLQEKIIERQAATRETGSVLTESQVYGRDKEKDEIVKILTNTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICVSDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLVAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNVRIRSLPRRLCKLQNLQTLDLHYCDSLSCLPKQTKKGYQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGILLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSAEVEYVEDNVHPGRFPSLRELLKKEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIATDATVLRSISNLRALTSLDISNNVEATSLPEEMFKSLANLKYLNISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIVFKRCERGIGEDWHKISHIPYLTLYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-902 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNDKPLENWLQKLNAATYEVDDILDEYKTKATRFLLSEYGRYHPKVIPFRHKVGKRMDQVMKKLNAIAEERKNFHLQEKIIERQAATRETGSVLTESQVYGRDKEKDEIVKILTNTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICVSDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLVAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNVRIRSLPRRLCKLQNLQTLDLHYCDSLSCLPKQTKKGYQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGILLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSAEVEYVEDNVHPGRFPSLRELLKKEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIATDATVLRSISNLRALTSLDISNNVEATSLPEEMFKSLANLKYLNISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCP

superfamily: SSF52540
134-383 P-loop containing nucleoside triphosphate hydrolases

ERQAATRETGSVLTESQVYGRDKEKDEIVKILTNTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICVSDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLVAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQD

Gene3D: G3DSA:3.40.50.300
153-294 no description

GRDKEKDEIVKILTNTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICVSDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLE

HMMPfam: PF00931
IPR002182
155-433 NB-ARC,NBS
NB-ARC

DKEKDEIVKILTNTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICVSDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLVAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

VLPILGMGGLGKTTLS

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

LLNGKRYFLVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CGGVPLAAKTLGGIL

superfamily: SSF52058
455-921 L domain-like,LRR

RSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNVRIRSLPRRLCKLQNLQTLDLHYCDSLSCLPKQTKKGYQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGILLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSAEVEYVEDNVHPGRFPSLRELLKKEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIATDATVLRSISNLRALTSLDISNNVEATSLPEEMFKSLANLKYLNISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIVFKRCERGIGEDWHKISH

HMMSmart: SM00369
IPR003591
524-546 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FVSLRVLNLRNSNLNQLPSSIGD

Seg: seg
525-538 seg

VSLRVLNLRNSNLN

HMMPfam: PF12799
526-565 LRR_4,Leucine Rich repeats (2 copies)

SLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNVRIRSLP

ProfileScan: PS51450
IPR001611
526-547 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLNLRNSNLNQLPSSIGDL

HMMSmart: SM00369
IPR003591
547-571 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVHLRYLDLSGNVRIRSLPRRLCKL

ProfileScan: PS51450
IPR001611
549-572 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSGNVRIRSLPRRLCKLQ

FPrintScan: PR00364
IPR000767
569-585 DISEASERSIST
Disease resistance protein

CKLQNLQTLDLHYCDSL

ProfileScan: PS51450
IPR001611
573-592 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDLHYCDSLSCLPKQT

HMMPfam: PF00560
IPR001611
573-590 LRR_1
Leucine-rich repeat

NLQTLDLHYCDSLSCLPK

Gene3D: G3DSA:3.80.10.10
653-720 no description

EVLEALKPHSNLKYLEINGFGGILLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTG

Gene3D: G3DSA:3.80.10.10
768-907 no description

PTLSSVKTLKVIATDATVLRSISNLRALTSLDISNNVEATSLPEEMFKSLANLKYLNISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIVFKR

HMMPfam: PF13855
772-826 LRR_8,Leucine rich repeat

SVKTLKVIATDATVLRSISNLRALTSLDISNNVEATSLPEEMFKSLANLKYLNIS

HMMSmart: SM00369
IPR003591
792-816 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRALTSLDISNNVEATSLPEEMFKS

ProfileScan: PS51450
IPR001611
794-816 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALTSLDISNNVEATSLPEEMFKS

ProfileScan: PS51450
IPR001611
819-842 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKYLNISFFRNLKELPTSLASLN

HMMPfam: PF13855
830-878 LRR_8,Leucine rich repeat

NLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCM

Seg: seg
837-848 seg

SLASLNALKSLK

HMMSmart: SM00369
IPR003591
866-889 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLTELSVSNCMMLKCLPEGLQH


List of References

Junqi Song, James M Bradeen, S Kristine Naess, John A Raasch, Susan M Wielgus, Geraldine T Haberlach, Jia Liu, Hanhui Kuang, Sandra Austin-Phillips, C Robin Buell, John P Helgeson, Jiming Jiang
Gene RB cloned from Solanum bulbocastanum confers broad spectrum resistance to potato late blight.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(16);9128-33
PubMed:12872003 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox