PRGDB00048596 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32470640 (AY303171)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum chromosome 8 clone UW177O13, complete sequence.

DNA Sequence

ATGGCTGAAGCTTTCATTCAAGTTCTGTTAGACAATCTCACTTCTTTCCTCAAAGGGGAACTTGCATTGCTTTTCGGTTTTCAAGATGAGTTCCAAAGGCTTTCAAGCATGTTTTCTACAATTCAAGCCGTCCTTGAAGATGCTCAGGAGAAGCAACTCAACAACAAGCCTCTAGAAAATTGGTTGCAAAAACTCAATGCTGCTACATATGAAGTCGATGACATCTTGGATGAATATAAAACCAAGGCCACAAGATTCTCCCAGTCTGAATATGGCCGTTATCATCCAAAGGTTATCCCTTTCCGTCACAAGGTCGGGAAAAGGATGGACCAAGTGATGAAAAAACTAAAGGCAATTGCTGAGGAAAGAAAGAATTTTCATTTGCACGAAAAAATTGTAGAGAGACAAGCTGTTAGACGGGAAACAGGTTCTGTATTAACCGAACCGCAGGTTTATGGAAGAGACAAAGAGAAAGATGAGATAGTGAAAATCCTAATAAACAATGTTAGTGATGCCCAACACCTTTCAGTCCTCCCAATACTTGGTATGGGGGGATTAGGAAAAACGACTCTTGCCCAAATGGTCTTCAATGACCAGAGAGTTACTGAGCATTTCCATTCCAAAATATGGATTTGTGTCTCGGAAGATTTTGATGAGAAGAGGTTAATAAAGGCAATTGTAGAATCTATTGAAGGAAGGCCACTACTTGGTGAGATGGACTTGGCTCCACTTCAAAAGAAGCTTCAGGAGTTGCTGAATGGAAAAAGATACTTGCTTGTCTTAGATGATGTTTGGAATGAAGATCAACAGAAGTGGGCTAATTTAAGAGCAGTCTTGAAGGTTGGAGCAAGTGGTGCTTCTGTTCTAACCACTACTCGTCTTGAAAAGGTTGGATCAATTATGGGAACATTGCAACCATATGAACTGTCAAATCTGTCTCAAGAAGATTGTTGGTTGTTGTTCATGCAACGTGCATTTGGACACCAAGAAGAAATAAATCCAAACCTTGTGGCAATCGGAAAGGAGATTGTGAAAAAAAGTGGTGGTGTGCCTCTAGCAGCCAAAACTCTTGGAGGTATTTTGTGCTTCAAGAGAGAAGAAAGAGCATGGGAACATGTGAGAGACAGTCCGATTTGGAATTTGCCTCAAGATGAAAGTTCTATTCTGCCTGCCCTGAGGCTTAGTTACCATCAACTTCCACTTGATTTGAAACAATGCTTTGCGTATTGTGCGGTGTTCCCAAAGGATGCCAAAATGGAAAAAGAAAAGCTAATCTCTCTCTGGATGGCGCATGGTTTTCTTTTATCAAAAGGAAACATGGAGCTAGAGGATGTGGGCGATGAAATGCATGATCTCATCCATGATTTGGCAACATCTCTGTTTTCAGCAAACACATCAAGCAGCAATATCCGTGAAATAAATAAACACAGTTACACACATATGATGTCCATTGGTTTCGCCGAAGTGGTGTTTTTTTACACTCTTCCCCCCTTGGAAAAGTTTATCTCGTTAAGAGTGCTTAATCTAGGTGATTCGACATTTAATAAGTTACCATCTTCCATTGGAGATCTAGTACATTTAAGATACTTGAACCTGTATGGCAGTGGCATGCGTAGTCTTCCAAAGCAGTTATGCAAGCTTCAAAATCTGCAAACTCTTGATCTACAATATTGCACCAAGCTTTGTTGTTTGCCAAAAGAAACAAGTAAACTTGGTAGTCTCCGAAATCTTTTACTTGATGGTAGCCAGTCATTGACTTGTATGCCACCAAGGATAGGATCATTGACATGCCTTAAGACTCTAGGTCAATTTGTTGTTGGAAGGAAGAAAGGTTATCAACTTGGTGAACTAGGAAACCTAAATCTCTATGGCTCAATTAAAATCTCGCATCTTGAGAGAGTGAAGAATGATAAGGACGCAAAAGAAGCCAATTTATCTGCAAAAGGGAATCTGCATTCTTTAAGCATGAGTTGGAATAACTTTGGACCACATATATATGAATCAGAAGAAGTTAAAGTGCTTGAAGCCCTCAAACCACACTCCAATCTGACTTCTTTAAAAATCTATGGCTTCAGAGGAATCCATCTCCCAGAGTGGATGAATCACTCAGTATTGAAAAATATTGTCTCTATTCTAATTAGCAACTTCAGAAACTGCTCATGCTTACCACCCTTTGGTGATCTGCCTTGTCTAGAAAGTCTAGAGTTACACTGGGGGTCTGCGGATGTGGAGTATGTTGAAGAAGTGGATATTGATGTTCATTCTGGATTCCCCACAAGAATAAGGTTTCCATCCTTGAGGAAACTTGATATATGGGACTTTGGTAGTCTGAAAGGATTGCTGAAAAAGGAAGGAGAAGAGCAATTCCCTGTGCTTGAAGAGATGATAATTCACGAGTGCCCTTTTCTGACCCTTTCTTCTAATCTTAGGGCTCTTACTTCCCTCAGAATTTGCTATAATAAAGTAGCTACTTCATTCCCAGAAGAGATGTTCAAAAACCTTGCAAATCTCAAATACTTGACAATCTCTCGGTGCAATAATCTCAAAGAGCTGCCTACCAGCCTGGCTAGTCTGAATGCTTTGAAAAGTCTAGCACTAGAGAGTCTCCCTGAGGAAGGGCTGGAAGGTTTATCTTCACTCACAGAGTTATTTGTTGAACACTGTAACATGCTGAAATGTTTACCAGAGGGATTGCAGCACCTAACAACCCTCACAAGTTTAAAAATTCGGGGATGTCCACAACTGATCAAGCGGTGTGAGAAGGGAATAGGAGAAGACTGGCACAAAATTTCTCACATTCCTAATGTGAATATATATATTTAA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Solanum bulbocastanum].

MAEAFIQVLLDNLTSFLKGELALLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNNKPLENWLQKLNAATYEVDDILDEYKTKATRFSQSEYGRYHPKVIPFRHKVGKRMDQVMKKLKAIAEERKNFHLHEKIVERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHIPNVNIYI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
2-940 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AEAFIQVLLDNLTSFLKGELALLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNNKPLENWLQKLNAATYEVDDILDEYKTKATRFSQSEYGRYHPKVIPFRHKVGKRMDQVMKKLKAIAEERKNFHLHEKIVERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHIPNVNIYI

HMMPanther: PTHR23155
2-940 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFIQVLLDNLTSFLKGELALLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNNKPLENWLQKLNAATYEVDDILDEYKTKATRFSQSEYGRYHPKVIPFRHKVGKRMDQVMKKLKAIAEERKNFHLHEKIVERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHIPNVNIYI

superfamily: SSF52540
134-384 P-loop containing nucleoside triphosphate hydrolases

ERQAVRRETGSVLTEPQVYGRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQD

Gene3D: G3DSA:3.40.50.300
153-293 no description

GRDKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTR

HMMPfam: PF00931
IPR002182
155-434 NB-ARC,NBS
NB-ARC

DKEKDEIVKILINNVSDAQHLSVLPILGMGGLGKTTLAQMVFNDQRVTEHFHSKIWICVSEDFDEKRLIKAIVESIEGRPLLGEMDLAPLQKKLQELLNGKRYLLVLDDVWNEDQQKWANLRAVLKVGASGASVLTTTRLEKVGSIMGTLQPYELSNLSQEDCWLLFMQRAFGHQEEINPNLVAIGKEIVKKSGGVPLAAKTLGGILCFKREERAWEHVRDSPIWNLPQDESSILPALRLSYHQLPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

VLPILGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

LLNGKRYLLVLDDVW

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

SGGVPLAAKTLGGIL

superfamily: SSF52058
448-806 L domain-like,LRR

EMHDLIHDLATSLFSANTSSSNIREINKHSYTHMMSIGFAEVVFFYTLPPLEKFISLRVLNLGDSTFNKLPSSIGDLVHLRYLNLYGSGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSKLGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLYGSIKISHLERVKNDKDAKEANLSAKGNLHSLSMSWNNFGPHIYESEEVKVLEALKPHSNLTSLKIYGFRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDIDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLS

FPrintScan: PR00364
IPR000767
545-561 DISEASERSIST
Disease resistance protein

CKLQNLQTLDLQYCTKL

HMMPfam: PF00560
IPR001611
549-567 LRR_1
Leucine-rich repeat

NLQTLDLQYCTKLCCLPKE

Gene3D: G3DSA:3.80.10.10
691-738 no description

FRGIHLPEWMNHSVLKNIVSILISNFRNCSCLPPFGDLPCLESLELHW

Seg: seg
742-753 seg

DVEYVEEVDIDV

Gene3D: G3DSA:3.80.10.10
751-925 no description

IDVHSGFPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQLIKRCEKGIGE

superfamily: SSF52058
757-915 L domain-like,LRR

FPTRIRFPSLRKLDIWDFGSLKGLLKKEGEEQFPVLEEMIIHECPFLTLSSNLRALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQL

HMMPfam: PF13855
811-867 LRR_8,Leucine rich repeat

ALTSLRICYNKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLALE

Seg: seg
854-883 seg

SLASLNALKSLALESLPEEGLEGLSSLTEL


List of References

Junqi Song, James M Bradeen, S Kristine Naess, John A Raasch, Susan M Wielgus, Geraldine T Haberlach, Jia Liu, Hanhui Kuang, Sandra Austin-Phillips, C Robin Buell, John P Helgeson, Jiming Jiang
Gene RB cloned from Solanum bulbocastanum confers broad spectrum resistance to potato late blight.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(16);9128-33
PubMed:12872003 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox