PRGDB00048604 (Putative disease resistance protein RGA4, identical)

From PRG Wiki
Jump to: navigation, search
Putative disease resistance protein RGA4, identical
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32470628 (AY303170)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Solanum bulbocastanum

Comment?

Solanum bulbocastanum chromosome 8 clone UW3A14, complete sequence.

DNA Sequence

ATGGCGGAAGCTTTTCTTCAAGTTCTGCTAGAAAATCTCACTTCTTTCATCGGAGATAAACTTGTATTGATTTTCGGTTTCGAAAAGGAATGTGAAAAGCTGTCGAGTGTGTTTTCCACAATTCAAGCTGTGCTTCAAGATGCTCAGGAGAAGCAATTGAAGGACAAGGCAATTGAGAATTGGTTGCAGAAACTCAATTCTGCTGCCTATGAAGTTGATGATATATTGGGCGAATGTAAAAATGAGGCAATAAGATTTGAGCAGTCTCGATTAGGGTTTTATCACCCAGGGATTATCAATTTCCGTCACAAAATTGGGAGAAGGATGAAAGAGATAATGGAGAAACTAGATGCAATATCTGAGGAAAGAAGGAAGTTTCATTTCCTTGAAAAAATTACAGAGAGACAAGCTGCCGCTGCTACGCGTGAAACAGGTTTTGTGTTAACTGAACCAAAAGTCTACGGAAGGGACAAAGAGGAGGATGAGATAGTGAAAATTCTGATAAACAATGTTAATGTTGCCGAAGAACTTCCAGTCTTCCCTATAATTGGTATGGGGGGACTAGGAAAGACGACACTTGCCCAAATGATCTTCAACGATGAGAGAGTAACTAAGCATTTCAATCCCAAAATATGGGTTTGTGTCTCAGATGATTTTGATGAGAAGAGGTTAATTAAGACAATTATAGGAAATATTGAAAGAAGTTCTCCTCATGTTGAGGACTTGGCTTCATTTCAGAAGAAGCTCCAGGAGTTATTGAATGGAAAACGATACTTGCTTGTCTTAGATGATGTTTGGAATGATGATCTAGAAAAGTGGGCTAAGTTAAGAGCAGTCTTAACTGTTGGAGCAAGAGGTGCTTCTATTCTAGCTACTACTCGTCTTGAAAAGGTTGGATCAATTATGGGAACGTTGCAACCATATCATTTGTCAAATTTGTCTCCACATGATAGTTTACTTTTGTTTATGCAACGCGCATTTGGGCAACAAAAAGAAGCAAATCCTAATCTAGTGGCCATTGGAAAGGAGATTGTGAAGAAATGTGGTGGTGTGCCTTTAGCAGCCAAGACTCTTGGTGGTCTTTTACGCTTCAAGAGAGAAGAGAGTGAATGGGAACATGTGAGAGATAATGAGATTTGGAGTCTGCCTCAAGATGAAAGTTCTATTTTGCCTGCTCTAAGACTGAGTTATCATCACCTTCCACTTGATTTGAGACAATGCTTTGCGTATTGTGCAGTATTCCCAAAGGACACCAAAATGATAAAGGAAAATCTCATTACTCTCTGGATGGCGCATGGTTTTCTTTTATCAAAGGGAAACTTGGAGCTAGAGGATGTGGGTAATGAAGTATGGAATGAATTATACTTGAGGTCTTTCTTCCAAGAAATTGAAGCTAAATCGGGTAATACTTATTTCAAGATACATGATCTAATCCATGATTTGGCTACATCTCTGTTTTCGGCAAGCGCATCATGCGGCAATATCCGCGAAATAAATGTCAAAGATTATAAGCATACAGTGTCCATTGGTTTCGCTGCAGTGGTGTCTTCTTACTCTCCTTCGCTCTTGAAAAAGTTTGTCTCGTTAAGGGTGCTTAATCTAAGTTACTCAAAACTTGAGCAATTACCGTCTTCCATTGGAGATCTATTACATTTAAGATACCTGGACCTGTCTTGCAATAACTTCCGTAGTCTTCCAGAGAGGTTGTGCAAGCTTCAAAATCTTCAGACTCTTGATGTACATAATTGCTACTCACTTAATTGTTTGCCAAAACAAACAAGTAAACTTAGTAGTCTCCGACATCTTGTTGTTGATGGCTGTCCATTGACTTCTACTCCACCAAGGATAGGATTGTTGACATGCCTTAAGACTCTAGGTTTCTTTATTGTGGGAAGCAAGAAAGGTTATCAACTTGGTGAACTGAAAAACCTAAATCTCTGCGGCTCAATTTCAATCACACACCTTGAGAGAGTGAAGAACGATACGGATGCAGAAGCCAATTTATCTGCAAAAGCAAATCTGCAATCTTTAAGCATGAGTTGGGATAACGATGGACCAAACAGATATGAATCCAAAGAAGTTAAAGTGCTTGAAGCACTCAAACCACACCCCAATCTGAAATATTTAGAGATCATTGCCTTCGGAGGATTCCGTTTTCCAAGCTGGATAAATCACTCAGTTTTGGAGAAGGTCATCTCTGTTAGAATTAAAAGCTGCAAAAACTGCTTGTGCTTACCACCCTTTGGGGAGCTTCCTTGTCTAGAAAATCTAGAGTTACAAAACGGATCTGCGGAGGTGGAGTATGTTGAAGAGGATGATGTCCATTCTAGATTCTCCACAAGAAGAAGCTTTCCATCCCTGAAAAAACTTCGTATATGGTTCTTTCGCAGTTTGAAAGGGCTGATGAAAGAGGAAGGAGAAGAGAAATTCCCCATGCTTGAAGAGATGGCGATTTTATATTGCCCTCTGTTTGTTTTTCCAACCCTTTCTTCTGTCAAGAAATTAGAAGTTCACGGCAACACAAACACTAGAGGTTTGAGCTCCATATCTAATCTTAGCACTCTTACTTCCCTCCGCATTGGTGCTAACTACAGAGCGACTTCACTCCCAGAAGAGATGTTCACAAGTCTTACAAATCTCGAATTCTTGAGTTTCTTTGACTTCAAGAATCTCAAAGATCTGCCTACCAGCCTGACTAGTCTCAATGCTTTGAAGCGTCTCCAAATTGAAAGTTGTGACTCACTAGAGAGTTTCCCTGAACAAGGGCTAGAAGGTTTAACTTCACTCACACAGTTGTTTGTTAAATACTGTAAGATGCTAAAATGTTTACCCGAGGGATTGCAGCACCTAACAGCCCTCACAAATTTAGGAGTTTCTGGTTGTCCAGAAGTGGAAAAGCGCTGTGATAAGGAAATAGGAGAAGACTGGCACAAAATTGCTCACATTCCAAATCTGGATATTCATTAG


Protein sequences

Name Description Sequence
Putative disease resistance protein RGA4, identical Putative disease resistance protein RGA4, identical [Solanum bulbocastanum].

MAEAFLQVLLENLTSFIGDKLVLIFGFEKECEKLSSVFSTIQAVLQDAQEKQLKDKAIENWLQKLNSAAYEVDDILGECKNEAIRFEQSRLGFYHPGIINFRHKIGRRMKEIMEKLDAISEERRKFHFLEKITERQAAAATRETGFVLTEPKVYGRDKEEDEIVKILINNVNVAEELPVFPIIGMGGLGKTTLAQMIFNDERVTKHFNPKIWVCVSDDFDEKRLIKTIIGNIERSSPHVEDLASFQKKLQELLNGKRYLLVLDDVWNDDLEKWAKLRAVLTVGARGASILATTRLEKVGSIMGTLQPYHLSNLSPHDSLLLFMQRAFGQQKEANPNLVAIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPALRLSYHHLPLDLRQCFAYCAVFPKDTKMIKENLITLWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEAKSGNTYFKIHDLIHDLATSLFSASASCGNIREINVKDYKHTVSIGFAAVVSSYSPSLLKKFVSLRVLNLSYSKLEQLPSSIGDLLHLRYLDLSCNNFRSLPERLCKLQNLQTLDVHNCYSLNCLPKQTSKLSSLRHLVVDGCPLTSTPPRIGLLTCLKTLGFFIVGSKKGYQLGELKNLNLCGSISITHLERVKNDTDAEANLSAKANLQSLSMSWDNDGPNRYESKEVKVLEALKPHPNLKYLEIIAFGGFRFPSWINHSVLEKVISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRSFPSLKKLRIWFFRSLKGLMKEEGEEKFPMLEEMAILYCPLFVFPTLSSVKKLEVHGNTNTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLKDLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTALTNLGVSGCPEVEKRCDKEIGEDWHKIAHIPNLDIH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
24-962 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IFGFEKECEKLSSVFSTIQAVLQDAQEKQLKDKAIENWLQKLNSAAYEVDDILGECKNEAIRFEQSRLGFYHPGIINFRHKIGRRMKEIMEKLDAISEERRKFHFLEKITERQAAAATRETGFVLTEPKVYGRDKEEDEIVKILINNVNVAEELPVFPIIGMGGLGKTTLAQMIFNDERVTKHFNPKIWVCVSDDFDEKRLIKTIIGNIERSSPHVEDLASFQKKLQELLNGKRYLLVLDDVWNDDLEKWAKLRAVLTVGARGASILATTRLEKVGSIMGTLQPYHLSNLSPHDSLLLFMQRAFGQQKEANPNLVAIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPALRLSYHHLPLDLRQCFAYCAVFPKDTKMIKENLITLWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEAKSGNTYFKIHDLIHDLATSLFSASASCGNIREINVKDYKHTVSIGFAAVVSSYSPSLLKKFVSLRVLNLSYSKLEQLPSSIGDLLHLRYLDLSCNNFRSLPERLCKLQNLQTLDVHNCYSLNCLPKQTSKLSSLRHLVVDGCPLTSTPPRIGLLTCLKTLGFFIVGSKKGYQLGELKNLNLCGSISITHLERVKNDTDAEANLSAKANLQSLSMSWDNDGPNRYESKEVKVLEALKPHPNLKYLEIIAFGGFRFPSWINHSVLEKVISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRSFPSLKKLRIWFFRSLKGLMKEEGEEKFPMLEEMAILYCPLFVFPTLSSVKKLEVHGNTNTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLKDLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTALTNLGVSGCP

superfamily: SSF52540
136-385 SSF52540

QAAAATRETGFVLTEPKVYGRDKEEDEIVKILINNVNVAEELPVFPIIGMGGLGKTTLAQMIFNDERVTKHFNPKIWVCVSDDFDEKRLIKTIIGNIERSSPHVEDLASFQKKLQELLNGKRYLLVLDDVWNDDLEKWAKLRAVLTVGARGASILATTRLEKVGSIMGTLQPYHLSNLSPHDSLLLFMQRAFGQQKEANPNLVAIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDNEIWSLPQD

Gene3D: G3DSA:3.40.50.300
155-294 G3DSA:3.40.50.300

GRDKEEDEIVKILINNVNVAEELPVFPIIGMGGLGKTTLAQMIFNDERVTKHFNPKIWVCVSDDFDEKRLIKTIIGNIERSSPHVEDLASFQKKLQELLNGKRYLLVLDDVWNDDLEKWAKLRAVLTVGARGASILATTR

HMMPfam: PF00931
IPR002182
159-435 NB-ARC,NBS
NB-ARC

EEDEIVKILINNVNVAEELPVFPIIGMGGLGKTTLAQMIFNDERVTKHFNPKIWVCVSDDFDEKRLIKTIIGNIERSSPHVEDLASFQKKLQELLNGKRYLLVLDDVWNDDLEKWAKLRAVLTVGARGASILATTRLEKVGSIMGTLQPYHLSNLSPHDSLLLFMQRAFGQQKEANPNLVAIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPALRLSYHHLPLDLRQCFAYCAVFPKDTKMIKENLITLWMAHGFL

FPrintScan: PR00364
IPR000767
179-194 DISEASERSIST
Disease resistance protein

VFPIIGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
252-266 DISEASERSIST
Disease resistance protein

LLNGKRYLLVLDDVW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CGGVPLAAKTLGGLL

superfamily: SSF52058
473-827 SSF52058,LRR

KIHDLIHDLATSLFSASASCGNIREINVKDYKHTVSIGFAAVVSSYSPSLLKKFVSLRVLNLSYSKLEQLPSSIGDLLHLRYLDLSCNNFRSLPERLCKLQNLQTLDVHNCYSLNCLPKQTSKLSSLRHLVVDGCPLTSTPPRIGLLTCLKTLGFFIVGSKKGYQLGELKNLNLCGSISITHLERVKNDTDAEANLSAKANLQSLSMSWDNDGPNRYESKEVKVLEALKPHPNLKYLEIIAFGGFRFPSWINHSVLEKVISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRSFPSLKKLRIWFFRSLKGLMKEEGEEKFPMLEEMAILYCPLFVFP

Gene3D: G3DSA:3.80.10.10
520-625 G3DSA:3.80.10.10

PSLLKKFVSLRVLNLSYSKLEQLPSSIGDLLHLRYLDLSCNNFRSLPERLCKLQNLQTLDVHNCYSLNCLPKQTSKLSSLRHLVVDGCPLTSTPPRIGLLTCLKTL

ProfileScan: PS51450
IPR001611
528-549 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLNLSYSKLEQLPSSIGDL

HMMPfam: PF13855
528-583 LRR_8,Leucine rich repeat

SLRVLNLSYSKLEQLPSSIGDLLHLRYLDLSCNNFRSLPERLCKLQNLQTLDVHNC

HMMSmart: SM00369
IPR003591
549-572 LRR_TYP
Leucine-rich repeat, typical subtype

LLHLRYLDLSCNNFRSLPERLCKL

ProfileScan: PS51450
IPR001611
551-573 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSCNNFRSLPERLCKLQ

FPrintScan: PR00364
IPR000767
570-586 DISEASERSIST
Disease resistance protein

CKLQNLQTLDVHNCYSL

ProfileScan: PS51450
IPR001611
598-619 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRHLVVDGCPLTSTPPRIGLL

Gene3D: G3DSA:3.80.10.10
680-976 G3DSA:3.80.10.10

SWDNDGPNRYESKEVKVLEALKPHPNLKYLEIIAFGGFRFPSWINHSVLEKVISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRSFPSLKKLRIWFFRSLKGLMKEEGEEKFPMLEEMAILYCPLFVFPTLSSVKKLEVHGNTNTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLKDLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTALTNLGVSGCPEVEKRCDKEIGEDW

superfamily: SSF52047
768-974 SSF52047,LRR

YVEEDDVHSRFSTRRSFPSLKKLRIWFFRSLKGLMKEEGEEKFPMLEEMAILYCPLFVFPTLSSVKKLEVHGNTNTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLKDLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTALTNLGVSGCPEVEKRCDKEIGE


List of References

Junqi Song, James M Bradeen, S Kristine Naess, John A Raasch, Susan M Wielgus, Geraldine T Haberlach, Jia Liu, Hanhui Kuang, Sandra Austin-Phillips, C Robin Buell, John P Helgeson, Jiming Jiang
Gene RB cloned from Solanum bulbocastanum confers broad spectrum resistance to potato late blight.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(16);9128-33
PubMed:12872003 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox